ELFE4Đ4 (446/usr/lib/ld.so.1 "%'()+,-01367:;?@ABCDEGHIKLPQRTWXY[^`acdefijkmopqrstuy{|}~  "$&)+,./13569;=?ACDEGHIJLMNPSUWY\]_acfhjknoprstuwxyz|}~  !#$&*./24589<=>FJMNOSUVZ\]_bghlnvwxz    !#%'(*-02478:<>@BFKOQRTVXZ[^`bdegilmqv{f@X &4 ch +HAsX QhW` hl0@ }\( T \ \8m , y|" P| |(  zT `\ '.lpL 8c M@ ]1 lF\ zM,H %0 $8 w f8 3x  zt z H'l0<T <FT( \e4lX }\  ` y"  ^ Qx   y )0T| ;Ay JV\TcLj1, ( H z4 y pS $X 0q8  z  *0@ 28kt DVT$ Ky T#pP la |N8 d$ <~ &t,  zT"  <#q, 2rH F, TZ$ cy" k( t&4 ˜@ Q( `O\ P ix Mt( y" #0 !'| 7r`( Gafq8 ~P X, 8ɘ y" z T YL )$4 5h\ >E Sipvl y Tq R,h  ( R zT v ` ~ " )/$ @G T\a$fo0L oy" tt}t w d X @M( X h t _ & - <l  Jp P\ Y`l kx  8 ut t @ D ph  t Z | $ 3 9  MS Wy ] c  m  sfh yl" w   gX 4(  #x mD`  z$" *@  '  M ! (c :&( Gz VqHH ex l { t 0 t ߼@ |x hdX D KD  w" H ! + 2L! :O\ AP RP4 [nX kw sUt ~n< "XH  P (Y  D jlt Π Th   t z4"  #(H 4"t J( W j s;d  }d %8 yl G`X   0 J X hy  ΄ j L %&40=D8 Q _%\ yd8 O$   o| >tH R  ,2  8 4d OD 06MT@ Av _xT n4 l| p  z$ t FL 8 ~H d 4jD  T  )/k$P 5 Dθ S&P$ jt~@ dl)`0 (s4 vD &$,  t ` r   Nx z" $*4DXPO  d  nh (  Lzd T zD" y\" " Et  L 8 #*l 6BRuL  emxlT zD y" [ h@!M x  uXL y\  *\ @ |  .gt <Ct N0 [y" dh@jy| rz Ld i D   H ~  I4 p8 18LAG`d Pz X|c ` tx $T r t( random_floatmap_ipv4_to_ipregister_htmlglobal_download_countwtimer_allocateclosenumber_to_stringfile_non_directory_pgetopt_long_onlyconaddrh_errnogmtimematch_tailhash_table_putacceptgettextlog_set_flushcookie_jar_newinitialize_s_netconfig_path_so_shutdownutimerun_commandfflushfile_sizeregister_redirectionftp_get_listingurl_has_schemeget_urls_htmlurl_erroroptsleep_between_retrievalspretty_print_address_socket_bsddownloaded_files_freemap_html_tagsfreeinet_addr__xnet_listen__xnet_recvmsggetnetconfigsymlink_so_recvstring_hashinet_ntoagethostbynamecleanupsnprintfsetsidftp_process_typegetpwuid__deregister_frame_infoftp_parse_lshash_table_get_pairsendselect__register_frame_infomerge_vecsmallocset_connection_host_namememchrgettimeofday_recvmsgstrcatfile_mergeabort_connectcookies_now.uremstrstraccessrewrite_shorthand_urlretr_rate_so_accepttotal_downloaded_bytesres_retrieve_file_getsockname_sendsscanf_so_sendtomake_directorylogflushlstatslist_free__xnet_connecthash_table_getlogputssrandremove_linkaccdir_sendmsgaddress_list_set_faultydownloaded_fileopterrireadsiglongjmpregister_delete_filereadlink_finirenamewritewget_sockaddr_get_portlog_set_save_contextsetsockopt_so_getsockname_so_listen_so_recvmsgslist_nreversestring_set_containsretrieve_treesleepsufmatchrecvmsgftp_systmap_ip_to_ipv4dl_url_file_mapftp_pasvusleepconnect_to_manyfnmatchsepstringvsnprintfres_match_pathdatetime_strisattyurl_set_dirmemcmpshutdownretrieve_from_fileqsortcookie_jar_savestring_set_free_PROCEDURE_LINKAGE_TABLE_readtextdomain_sch_tolowerftp_cwdprogress_updateftp_last_resplineftp_portsendmsg__xnet_sendtoip_default_family_so_connectmemsetmmapnetrc_listreallocfreadhas_html_suffix_pendnetconfiglookup_hosttime_stroptindheader_strdup_GLOBAL_OFFSET_TABLE_atexitchmodrbuf_peekstrchr_shutdowninteresting_attributesstring_set_addtest_socket_opengetoptfork_to_background_setsockopthttp_loop__getopt_initialized_lib_versionstrpbrk_etextfgetchash_table_clearfilenorbuf_discardfprintfexitstatfree_vecrecvstrerrorget_contents_socket_svr4memcpysearch_netrcstrdupftellmd5_process_byteslocaltimeurl_set_fileprogress_createres_parse_from_filewtimer_elapsedlegible_large_intperrorbindtextdomainfile_exists_pfgets___errnoregister_downloadvalid_progress_implementation_prandprogress_handle_sigwinchrandom_numbersetoptvalfreopenptrhashslist_prependset_progress_implementationvfprintfread_whole_linedebug_logprintf_so_setsockoptfstathash_table_containscloseport_recv_statsetitimer_exitconvert_cleanuplisten__xnet_socketredirect_requestxmalloc_realgetopt_longgetenvaddress_list_releasesuffixunlinkgetpeernameprintwhat_endrotate_backupsurl_escapestrlenhtml_quote_stringsockaddr_len__xnet_sendmsgslist_containsstrtokhash_table_mapstrtolwtimer_deletecookie_jar_deletemake_string_hash_tablemd5_init_ctxrbuf_flushxstrdup_realstrcmpcleanup_html_urlftp_retrsocketprogress_schedule_redirectlog_closemunmapenvironiwriteinteresting_tagsftp_loophas_wildcards_p_socketacceptableread_file_freeherrmsg.remgetuid_edataftp_rest.divstrdupdelimgen_md5_finishmd5_process_blockhash_table_newftp_listgetsocknameheader_extract_numberaddress_list_match_alladdress_list_copy_onehttp_cleanuphash_table_destroy_so_sendmkalldirsmainhost_cleanup_listenget_urls_filemake_nocase_string_hash_tableres_register_specsprogress_finishbindportexec_name__dtoll_recvfromgen_md5_updatecount_charversion_string_so_bindstrcpy_sch_toupperheader_existswget_sockaddr_set_addresslog_request_redirect_outputscheme_disablelogprintfslist_appendfcloseurl_file_nameselect_fdftp_indexstrptimeurl_parseheader_geturl_full_pathftp_loginschemes_are_similar_pfputcacceptportcookie_jar_process_set_cookie_socket_createhash_table_countres_get_specsgen_md5_initftp_size_getpeernameftp_typeuri_merge_sch_istabletime__eprintfhttp_atotmfputssetnetconfigfrontcmpsignalconvert_all_linksftruncateioctltouchheader_processmd5_finish_ctxwget_sockaddr_get_addrsigsetjmpcookie_jar_loadmkdirstrncpysprintfcalc_rate__flsbufnumdigitrun_with_timeoutwget_sockaddr_set_portstrrchrmktimewtimer_newfree_keys_and_valuesurl_schemesendto_so_socketsetlocale_so_getpeernamestrncasecmpscheme_default_portres_parsegen_md5_context_size.umulforkstring_cmpasctime__xnet_bindhttp_process_set_cookiegetsockoptbindaddress_list_get_bounds_startrbuf_read_bufferfullog_initfseekres_cleanupoptargunique_name_so_sendmsgwget_cookie_jarwtimer_granularitystrncmpcookie_jar_generate_cookie_header_getsockoptconnectread_file_ioburl_free_so_recvfromrbuf_initializedetermine_screen_width_bindptrcmprewindfree_urlposftp_pwdopenrbuf_uninitializexrealloc_realfwritefree_netrcftp_responserecvfrom__iob_accept_so_getsockopt__xnet_getsockopthome_dirxstrdup_lowerretrieve_urlfopendownloaded_html_setmd5_read_ctxrbuf_initialized_pskip_lws_init_DYNAMICatoiurl_stringcalculate_skey_responseoptopt_environconnect_to_one_sendtostrcasecmp_getopt_internalhash_table_removeaccept_domainprintflegiblewtimer_resetlibrt.so.1SUNW_1.1libnsl.so.1SUNW_0.7libc.so.1SUNW_1.1SUNWprivate_1.1librt.so.1libnsl.so.1libc.so.1 =' =( =' Nq49Lh}\  ,489DP\ht8eB%4,d\(^4M@LrXkdpO|J=> R$0S<bH*TF`xl[xoc @E&-. b,88 DP \3h&tz}iPvo;(p41@LGXdZp|0X{>SX `$h0+<jHJT`l+xkPjiN) @D# @ߐ"@@/, @ gL"@] @@㿐/` @# @   $?@`  ``@   "㿐㿐/ʮ✐ `` @ 㿐XF.`ij6` @7#@7'1J "@ꢒ " @Ꟑ# @Z  @ꕐ#ȗ,`2@Z Ē @ f#!`#@4Ja'"'?c@r J`  cal "@5Z   J@_"al@Z  |@6n @6 $ J| @7%@7Y@F )@7Pc`U'$?'Ȑ  h@# "@/ "?? @&`@  "̀  @ca, ߐ#@Z? 2 g@#@Zg g 䀢` @Z0@ !@ @@ZP @"x!>  ??$ ? '@B   $ ?c @Ϙ  J  `%fal @4   J@鷐"al@Z  |@5ƒ @6$F!IJ `J |  @6y @6`@ 6@`a, `@Z%#?$`C !, `@Z 0 &`@6'`@k؀ @s`!,``@Z#?$`! @6i6!, *` P@Y2``@   @T`a, `@Y#?$` @6Rf >'d`   ?X@=pXD x4`p* ` * ’@$ 'h FD'l`  @'h  @``  @  "  J d@x &  !,` `@Y  g ?`` B5  @p`H 4p*@  * ’@$@ 'hFB'l  @טh  @`  @ " ?@?@`R f# 4 * *  B1?`p @藔 `H p@$@'h…FB'l  @腘h  @t`  @k " ?@s? @[` &@㿀@4[6?.`@4U6`|  @4y ?㿐 J `"" ߐ#8cXh@   `2 " ߐ#8cX@ p  @6 *   *@$ 'l 'h  @h`?p  'd'`@6 *   * @$ 'X'\d`XB"` h'hX…FB'ld` @֘  @`d @ "㿐? >@結g`䀢 ߐ#@XD> 耢?" ?@g`䀢  @X4#?& x 'ܐ@܀   @4 @㿐 @ & 㿈@!J' @  `$ f#J`@0  a, O@WK В@W@<: ` 4f# 7g 31 2  "$ @0X " @$ $ a, @Wǐ` 2  2$  $ $ a, " @W!  2 @!@u0J@聠@@'@!8 `?@W\㿐@!h@WR    ` ` 2``2`@ِ!@V 0@2 @͐!@Π@@W* 0@ g 쀢` @ @А  @` !a@Đ `!@@栠@ @V@0f#5/-;`    a, y@W!v`  a, "j`@@Wd` $@@挖`   W - "M`T``@j@s`2  `@` @a, 0@`@V۔@`@^,@@`2  `@Ŗ` @a, ``@V@<  @b@&``2` $ " @!@%@%b@V\ 㿐N@ /2N@rR /  "bȖ@Д!d N   N@ / / /  N@ /  @   * :  /"`N 2* ,`@ߐ@  b b薂* * ** @Ȓ㿐@`   ?#`@帐 b@*b `* `* `* `.@ ?#`@壐 b@.@b `* `* `* `* `*>   @[ 2  @兒 @O#@P@T @U@ @Ő`$$ $`㿈@@^  ?#`c @\N  " " '2   ? &, : @I* &@C@耢  @" ? &, : @&0* &㿐g!`3@Ւ ? .@,  ` ?#N`   % 3 FN ?**** N " " *"bȖ0@"[ @㿐N N`` N@ @" "( N N@ "  `N@ ` 2N@ /2N@ /N`  @tcH`?㿈J `@, $ gb  @, $   @- @S ;  @-  @,1@h@fYb(@-֔ @@@+Ӓ@-r  @,@J@H@@@+㿈 JJ 8 @-- '1 `  @,J $``@- '" >   >'>  ' '> ' '`@b@+y 㿐!J 2!g@, $ !g" @, $""@,  ""bȖX@#@-$  "@5@2@+I㿐g" @+ $"@-   "@r!J @$ 㿈!J #g@+ΐ $ #gb  @+Ɛ $b @,耢   @+]@@Ybb(@-㿈N  " " '2   ? &, : @㆒* &@【@耢  @["` ? &, : @c0* &  J#&    ` ""  *J 㿐@  gb@*@$@" 㿐!J "!g@@,  $ !g" "g@@,"$"g" !J@@ $ 㿐!J Yc$@,k @+ $ 㿐@ p@@,耢 V@@+'f "$ `@  2` @ 2` @" $ ( 2`$ 0䀢` ("`(&`(&`( " @  " @ " $@ $ @@➐ ?& a, @S #h &`(@@&`(''f@*  & a, ,` @␐`@#`@###` `##`$#`` #h` #\#d@R͔㿈@+ f@+F@ "$ `@  2` @ 2` @" $ ( 2`$ D쀢`" ("`('@+? 2  ( ` 0@!)@)@ @) " @  " @ " $@ $ @@g 䀢`@Ra @㿈``2   ` X@!U 2"@ " @& @& $  `@ݔ    "  "N@N ."@&  `@ἔ   e c"~   "@@nr& + `@᠔  # I GE'  ?#`@ᑔ,@@FN & & g" @ 6K  G& 9 `@u  1  ?耧 '  ?#`@c,@`@` Bg "በ` B & HD& & 2  `@<  2  &  㿐@~@ ,?& && & & & & & & & $& (     \",  €,: à  #8*` @2ߐ ]"=~;|,z ,:  ; =  #8*` @߬  ]a"_=];[,0W,:   ; = ; X U  | c8* @?@,:   ; " ;?<  b c8* @@2; W ,:   ; c8* @@"F  C ,:  "  9 25 ,:  ;  ,  c8* @@"#  @   %  ?#`@X,@@ @Pq  ? / , " @!  " @ " $@ $ @@  @  @ߐ $ @P@  ooop`pq,qdqr0r0 @8( ?` @(  ` @(2`J@.-` @8("1 ` @(2`J@.` @8(" ` @(2`J@. ` @8(`  @(2`J@`?㿐f#a,`@P ! @f`?a, @O!@ߨ "| a, @O! @~%  dN .    a, @Oݐ!( L  .2 "X L  2  ` #!, @O!0$B !, @O!8#>!   ,  @} "  `#`$$ !,`@O!xN ."#@ @ "J?`.#  #!,` @O~! 㿐@) g"bZcP : @|P'' N 2   a@O#@0 `@ 2 g 䀢` !@OE @|)'   ג0 n  " @޵  " @ޯ " $@ީ $ @ޣ@ޡ㿈'P'L'T@|g .*  ?#`@($     @|R . @ީ . @'u ,&`@"b @ޔ g  "bG ,>`"@0  T ) ?L "  " @i  L /   @<P@a  `   2(2,- '*   ?# `W  ,M`"@4  T - ?L &  " @  L /   @P@   `   2&  " ($@̮ `$$ (2,@  ` @z$a@*  @ؔ !  @q $@k $  " ` $@ $` $``   値$@* *  *  *  : ad@ݤ  @6` @m @j`$ @*  @z aa.  .   .  .  .  .  .  .  #.  = ; @> @; $ @Q@.` $@J@.`.`  .` .`.`@  ` @ؔ$x'Db @  '!@ݠ"(@@M9 0;@ g0"b'J@   c8J  * `@2J  #  J  2  'J NJ  2 M MJ  2 M@ `M`J  2 M Ӻ M J  2 @M ¦MJ  2 L@ `@xL? "?L? "?@y ,?&`&@&`&` &`&`&`&`&` &`$@z4&`(&` @z0&`$@z,%`&`  bP@u `?%&`   bP@i   &` :@a$   ))  c8J* ?Д  * `,`  $ 2&`N ."@yސgbbX&@ƒ ?@-g"  F&`D&`0@ "`@` "` @` "`$@`$ @@Ő@@u؀ '@ۿ؁㿐f#,`"@L(@א g"bb@ۡ @}"(@~@ۂ@Kڐ 0;@۩"!"@y @Ȑ@۝"ab@$ `  @Y#@Z@^ @K@u 6,@H# @I@M@K , @K֐#8㿐@x @# $$ 㿐a@$c@$?@G㿐N@ / `@C@h   㿐@` @ @`$@$ " `"` " x`"F #!%` ";`(`g" &3`(`  .@<@`@0``"h`b"P` ` "Pb` ?` #``$#d@#\ ` "`( `2` 㿐@"@ǐ`@ `(@ھ` "` @ڸ` "`$@ڲ`$ @ڬ@ڪ 2@ 㿐 !8c8'N  (2 N T N  * @`@"N8 N  * `@2 N < * @`۠ 8N,  N* ?Ѐ @ * `2N# * @`@"N8 N  * `@2 N  `b2NP@e  2N `'Ѐ  #Xcx@| ! (`  #Xcx@|  '#Xcx@| 2 (#Xcx@|ה , ''@U䀢`g L 'g P`'   #Xcx@|   ?> ' , "  ,`" `  ,`@ѐ@@v `@@$ ^ l,2` Dd @% @ه `If#Ā`"E 0C@\@\@\ؐ@l @Iΐ fc!$`8@I @`, @w?`(ej"*` €`8@H @C @@H @Df `8@H @4 @H @5f`8@H @% ؒ@Hڐ @&fa,  x@I@\Bܰ `8@Hǐ @  @H @ fa,  x@I@\)ð fc!$` f@!@H f@!$ a @IG `  @  f0  `8@H @ʐ!0@H f@!$`2 f @ع!`@Hn f#a$ ap@I  $@c "  !0 "0`8@HO @ؔ @@HI @ؕa, "@ج@v !&@ؙ `If$ @Ȓ [  @Ò ] ` fc!,`1@H!.f $f, @H!, @H! / ,@L / .  ,@  `,@f!,` $@HҐ!f#a$ @-"@G @a$  , , b:@H , : @; "( "=a$09  703`8@G @ @@G @a,`8@G @ @G @ a,`8@G @"(@HJ @a,` x@Hx@[ @  @ϐ"X@G  M 2f"`#a,@HV"xL/U ` c8*@ L :D `=$@ J?`/ ?  J?`/"?@ׯ  ?#`$h@׿ /,@@@ס fc!, @H "!, "Ȕ@H `;f@ׄ ?#h@׀L@`/" L`#Xcx@z7! [`,@ ` .J@ /"*@`J@  / ]*@*`f!, @Gʐ#!, #(@G”f!$ cH @G@ : "O!$0K  70E`8@F @ @@F @!,` x@G@Z `8@F @ @F @!,` x@G{@Z  7`8@F @Ԑ#X @G6 @Ԑ!,` x@Gd@Y @ 2 "@ֺ@Fo  @ֳ#x@Fh <:@ 7f#` #$ $c@F $@   f0  `8@F; G @@֖c!$` @v"@F+ ̀f#`$ c@F  @ ް?`(Dj"T*` €`8@F @I @@E @Jf`8@E  @9@E @:f#a,  x@FȒ@YV0`8@Eܐ #`8@EՐ #@@Eΐ  @* >ސO  )'@ @ fc,  x@F@Y$@#@"kޠ@@FM   e f!$ `'@א!`@E Ѐ ~fc!$``@E~ @ ?`5]j!|*` €`8@El ; @`8@Ee @ժ @E_ @իf5`8@EV !@՞ (@բ@E @ՙf##`8@ED @Չ 8@Պ@Վ @E0F`8@E2  P@v@E+ @wfa,  x@F@X0+@yf!$` @X!`@E  jif#!$``` @E@ / " E 0@ " 709`8@D @, @@D @-!,`" x@E    @ x`( @Eu @!,`" x@E (@ @D  @  fc!$` @!`@D f# T`f@!,` x@Ev# *@X0 "!$ `8@D} $`@E& $@  A If0E  70?`8@Da @Ԧ @@D[ @ԧfa, " x@E4 `8@DI @Ԏ @DC @ԏf#a,  x@Eذ 7@W0A`8@D. @s $m @ԅc!$`2 f@e"@D f#8 mf#!$``@D  @   "= "J!$0F  70@`8@C @7 @@C @8!,`" x@Dǒ `8@Cܐ @! @C֐ @"!,` x@Dذ 7^@W<0֒`8@CÐ @! 0@Dh M0@ 2 f@"@C fr#8̀ *f#`T@ `"@ f!,`@Dn!8@Ѐ fꋐ؀  f!@Ǡ!`@ʰ @D# 0c`` 9 (@ea8`"@`@ !!p!x@ӻ 27@ (!@ӗ!@ӛ@C @ӑfa,  x@D@Vʰ 0D g!H`2@g!x" @@֐@א@ؒ `, @ @`!@ss@@C "@S!@@se"@@C `8@B "@` !@?!@sR@C " @2!@sE&@@C @(!@Bݐ ! #`ؚ#\@]x@p @  "@` Tf ` @"?@i?"?? ?@!`( @@@CH @f#a,  x@Ct@V @ΐ!@Ϡ@ @C*fc!$``8@Bs @@V !@Ԁ?b@C @ҥ"@BZ @Ҧfa,  x@C4@U\ J@ 2@ұ ?b@B @҂"8@B7 F @ҟ ? ? f@xfa,  x@C@Ufc!$`* * & (@d@tbP ##@Ra@V@B  *bX@B@e@l0  @a *`xTp 0lT (  @d&f# @`@p   @ѕ"`@A b " (@oc`    &2 T 'P @^/   &@T  ? @T  ? &  ? &  c `! c@o @Ѻh  c|<  "c ` &@nʐ c`  @f"" ` ?X/` X@"@J b@Au@1`"'T`'TP@T(  ? &? 6l* @€`T`@ c @^c@@nz c T` T     @^q"쵐 `"c@!,`@A[ x@Sc T 2 c@д"ВT @Ac 2  2 @f[T #\b@@@к cH = Tgb ;  B ;b0 cT , Tg ;  `B 8` , "@A#@e#P @@ǔ@z  !@]#`@a@@    ?& "  "Ш &ͨ @Sj  , @?!,`@@ϐ x@S] ,㿐`) (@ @ ?&` &@@b@hpcp@fc!, @ِ#@@t&@ % "&@ @@7&&#!H`@ې  !@Ͼ#`@@@ 0@ϱ# @@@ϐ` ?&`f>c! ,`"!@ `!, @ϒ# ,@@, #`2 #Xcx@rq%('d `&  ?&`@R&   ?&`D "f #`(!! "g"! "2   (N 6! $@l϶ "`@f@bM&!0 = @ ;  @Ϭh 24@    ` ` ``?`  ` @#@?|  " @ 8@?q  @@ x@?i @ "f  p  ty@ g``  `(@ @> i@@\h *@ `|< (    ?#` @J`@" 2@ ؒ `@?" <@@η! @?`@`@+? @Ϋ@ί @? `8@>U @ 2@@Ε!0`@> @` ܔ@΅!P`@> @ 2`  !` ?``(@l fc `  2 "`` @l `` ?2 `@T!x@> ``" !,@ 2!,`"!,@Ω0 @>ؐ!@]&@e@W6   f ?&``2!f` f`, fd@#   !, @! ,@>?%㿐 `q)f#/-+  g" c"2@  ^#@ 2V`@  @`     ?#` L  /2 `L  2 ``@#@#a, @>S"a, `b@@>K@f  2 @ͥ"x @>` ?&@k  @d`@! @dY@Ͳ``2#aa g"a "  "   6 "㿈` &` w "f c`X `\  "# " @f  2  @Mb @= @S 2쀤 " $%# J@ /  @͵@ "  @-b @= @3 2  $J`,) ( )2 @   $@͋ `@@@!@=` @ 000쀢`I0 @`&@6 @ސ"В $@=@ @caa g"a "  "   6 "-?Ф' 0&@@@O $ $,$ $ $$ J@ [5f  V4  "v !L "E? T 2A? "(@j  @j@_#?c4@ # ! ` cH@@ܒ ?`0@`" @<0@X# @<@v?c4@r * @k] $`  ` a0  ?cЀ@    ?А@ y  " " "!?@ &@#А@@O@   #@@a, @@< x?#3@`$ "$@$$`( "$@$㿐  @   @ @  2& `"&@$`㿐  @   @@ 2 㿐@i (`&@ (- ?!- @@i!&@! ` &  @ *@&  &@O `&  &  @ *@&2H @J@ 2ͦ *@@J?` "*?ff#!$`"!,@ @;ݒ8  @@< 8 @ #8*` ? * `? * `?J ?!f#8 @Ԕ ,  㿈 { J@ 2@]  @Y #@[` @V  @hx`#@#P#X`#X@Ef ca$ c`@[  ch @;fcp@:  a, #@;@H @ J`2`3">@ 0!  `.`@@  2``+>a .`@ @  В `` J,  @*`В@ J @İ 0n @   c`@ʷ @ʻ @ʶ  @gc@#P#X#X@ʧ#a$ c`@  ch @:˔cp@:  a, #@:@}ᮒ @n 7@j{ @a0 J@ 2 @Z 0@W  P7F  v⑒ @H i Є `2  ` `c#\ `#` @;#c@. @+@gP c@P@)fca$ c`@@  ch @:Kcp@9  a, #@:s@. @ 7@ @0 J@ 2@ڐ  @֐  㿀!#@Ԑ@f Xc@@Ә fca$ c`@  ch @9cp@9A  a, #@:@ɧؒ @ɘ 7@ɔ @ɋ0J@ 2`@Ʉ  'L  c8L  * `" L #i &c8 . * ` 8 Б*` * *   * @` L ,%   @@6 c8* `  * *@ : *`?А 6  * ` L , @& &0! c8*  ` * 2` *`+  *: Б*  `+` @6 㿀#c//@ @@f# c@P@fca$ c`@  ch @9cp@8j  a, #@9F@А @ 7@ȽΒ @ȴ0 J@ 2@ȭ  @ȩ  㿈#@ȧ` @Ȣ  @e䀦`#@#P#X`#X@Ȓfca$ c`@ȩ  ch @8cp@8  a, #@8ܒ@fߗ @W 7@Sd @J0J`5`2@C 0@> 0@; 㿈J @cc@5` @0  @eR䀤`#@#P#X`#X@ fca$ c`@7  ch @8Bcp@7  a, #@8j@% @ 7@ @0 J@ 3@ѐ  @͐  㿈 @ː` @Ɛ  @d䀦`#@#P#X`#X@Ƕfca$ c`@͔  ch @7ؔcp@7$  a, #@8@NJ޻ @{ 7@w @n0J`5`1@g 0@b 0@_ 㿈 @^` @Y  @d{䀦`#@#P#X`#X@Ifca$ c`@`  ch @7kcp@6  a, #@7@N @ 7@  @0J`5`1@ 0@ 0@ 㿈! @@d Xc@@ fca$ c`@  ch @7cp@6^  a, #@7:@Đ @ƵI 7@Ʊ’ @ƨ0o @/* 7@+< @"0J@ 5!@   P @{@x @ @ @cj&@@ 㿈 X@` @  @c!䀦`#@#P#X`#X@fca$ c`@  ch @6cp@5]  a, #@69@Ð @Ŵ&* 7@ů J@ 5@š & @{"  @ @s&`@Ŏ 0 @Ŋ&㿐 ``@ŝ  2  IN `"8 `J  I('H`@d '!@C @F @5 0f# ~ @Z 'J?` ` - J?` 2M- M   L ", L  '`ؐ@K  @ō`࢒ ''L@ d"  l - "' ''a, @5 H'a, @5| H 'a,  @5r! Ha, @5j!H   !!'a, 2@5X!(.`@   x' L,` rL @? `x `s2L  L  w2 @? 'a, @5+!@f #c8''  ' ''A?@> !( ,@q 2 0 ' * `#8L@,@?' * * @`2L  'a,   >,(@4ސ!PL`"L@L@Б*` *  ?'a, @4ǐ!`f @ *  @`'G #8`L@- *`+`*  :? @ :5` @* ' ` @#8` @.*`+ * @ :? @L@ :` @* ` @#8` @/ *`+ * @ :? @ a, !p@4k倢 !@4a@$@"   ,@`a@.  @a- 'a, @4=!,a@Ø a@Ò  a, @4)!А R'@ñ@`Ր@'8  J / *a, 6@4!3 J @ *a, %@3"" IJ?`*2*?a, @3"   '@X @ƒ࢒ 2    f c 'fc!, @3"82!, !, @3"@ "@4 @.@,0R2'@`U &&&& &&&&@`B &`&@&`&`&` &`&`&`&`@+ '@''''Ԁ '``?'''܀'k$?8'ܐ?'''@L&` @ڐ@\ @ְH`@Ő  !@¤ @§ @2 0ް @¾ J?` ` -@ J?` 2M@-@ M@   L ", L   '@_`''f#a,`"P@2 "`@@?, @ߐ @ @֐ @F$dbh@̐ @bp@Ő @Ϡ`   L P"` a,  l"x@2š?'''''''''@¬Ȓ'a, @2"  @•L  L < !'''!,`@2"'@ˆ'!''!,`"@2 ' 2'@_2 && & & & & & & @_ %%%%% %%%%@ސ@[ !@ڐ@`@ɐ  !@ @ @2 0@[  @@[ @@[| 0@  J?` ` , J?` 2L, L "   L ", L    @`࢒ "f#!,`#X@1L@ %L  ;2 L ;",@h@p@7? ",?@^'a, @1ɐ"PL? 2 ' ''a,  @1" 'a, @1#x' @`࢒ G!, @1#@,@Z  !, ;@1#07@$  J?` ` , J?` 2L, L   L ", L    !,`.*#@W`!, " @1`"`@H !,  @1R@I@9 2  !,  0@1B@ǐ0ݴȀ  , >!X @ 2 @, `@ @"8!,`@1  `@  @L  L  :2 L  : @L  :2 L "@ !,   p#\gl@0?'''''''ܐ'@''!, "`@0א"`@  @  @  !, @0Ð @H0Y ?ԑ* : `+|#T*` €,       !,`@0"L 2 '!,` @0'@]E &&&& &&&&'@]1 &`&@&`&`&` &`&`&`&`@@Y A@                                       㿐`* 4``(0)`@  !@ @ @/ߐ 0!@@?Ѐ    @`!@/Ð  㿐f# a8@h 2`(!@G @J @/ 0O`( "4@U`,  @U@T` @O  @\qa@`"h!H`!H@@@/` @*@\!HaP@]a@Y!!@` `@O` a@K@` `@C` a@?>! /)+a@4 @   +  !  @$l  b@b@@" @ "   0"8"H"X@@0@"h@@Z`bx` @` J@ /? & /@ * &  ` b@Ґ` J@ "? & /@" * & "@`? & /@ * & b@`? & /@n * & b@  @'"@^:@2 怢""@s? & @A0  *@`& @'*b@[@ `@ @` 㿀,` @ ?` /`/`>/`/`/`///7 'f    :`@ *  *`# * ` 2   ?@+`/*@ *` 2 *   . *`.  `.  . *  * *`       .  `*  * 2 ḑ*  @  . *.  .  . *`  * +        .  `*` *  2  '*   . *`.  `.  . *  * *`       .  * * 2 ḑ*  @  . *.  .  . *`  * +        .  *  * 2 ḑ*  @  . *.  .  . *`  * +        .   `* ` *  2  '*    . .  .  . . !,`"@-Yx@3  ?#@ۤ`@ؐ  ?#`@Ӑ@B@3@ɐ@3آ @3 ؠܰ?@ ''?@3@3 @3 ذ?@ ''?1J 㿐J3FJa@.@,(`'@ @'@/`/ @ &@`@ / @&@ `@@ۆ'@` " "`㿐F!g'D'P"b%g` //Ja %aaJ!JJ"`""@$ ԒJ" N -J "` +`J"  J" J "`ؐ $`Ԁ "JJ PJ a@ $ J`  $`J`؀ ( ` 䀢 @  bF a 2$`FDD "Ḁ  *@J`-2J  $ aD@ !*`@ @c aa`  䀢@  %a`- D` 䀢@Da$`D$ %aaD  *` 䀢@2%a?@J`-J 2P؀ ?g"%a V   -`?`%P (a* @J -`"!J  N  J@  `J@    Ԩ P L ?L  =2P` @@z$ 2`@@I$ 2 `@    F!` !g!@#a*@ @^@@% ?Fa@%%a" ua%aL 6  g["bF!`!*?J`- !g!@Ԑ#(@@/!@ɐ#Xa*K@@@ ?F @%" *D F*@g"" %a!`!g!@#a+ @@?@F @%"N ? :" :0@Ԁ @%' `" ` `a* @J`-ԔN  J@J  J   0F!` a* @J`- !g!@R#@@a!@G#a*@ K@@ac F%%a"a ?Ԕ  %N. ` : J " ԔJ   J a %a. <`:2$JF!`J ܀` !g!@#@@`<` <`!@ @@U<`<`F"! ? W `;ԑ*`J    ag "b)%aaD*F!` !g!@ϐ 8@@*F"!N`: ? :. > , @g""%agb%L@  =2`P  @$@ 2@Ƞ$@݀2    F!` !g!@ `a*@ @@@ ?a@%%a"W%L@  `g="F!` !g!@] @@@ ?Ԓ@~%Ԁ %aD F*@g""%a!`!g!@;#a+ @@?@[԰ ?@%N@SԀ @%'`"L   H"@F W*`:  :2A<`J :J@ ag "%ag""/%J@ ag "$%aaD*F!` !g!@ 8@@G<`. : F"aN:  ? :@g""%a%ԣ. <`㿐   㿐 㿐 㿈   *  * `G  *` ```G*`@#@ '!؅*`& FB@U&  *@ #& @ `@@" * `    @"`"@*@@㿐 @ @ , ?* @ @ `  2)"   ! @ @ , ?* @ @ `"   & ""㿐 @ @ , ?* @ @ `"  2 <  $ *`@ ? &    "+   @@ * @`@@@  @" "$  2 㿈!!!<@U  $@!$@$`!$`'煠$`` !! FB'* G(*@# '!. $`FB@T$``$`*@ $` 㿈"d!"@T  $@!$@$`!$`'煠$`` !! FB'* G(*@Z# '!. $`FB@T$``$`*@: $` 㿈@Tz `$!$$ !$ '煠$   "" FB'* G(*@# '". $ FB@TC$  $ *@ $ 㿐@  @㿐 @ @~  , ?* @@ `"Ā    㿐 @ @[  , ?* @@ `"Ā   2&  & 㿐 @ @0  , ?* @@ `"Ā @ 㿐   @x*& 㿐  *   @   2  * J@`J@ @`**J@ 8 @  㿐@+`?* 0(0 ( 0(0  `? @8 `J@ @ `*J@ @  㿐@D`?㿈@SD P`8&@ P ?@!- @@SK&@! ` &  @ *@&  &@9> `&  &  @ *@&:@J` 92@``J @8ؒ 2 "O ! "`@`f@ ?*` @ #8`@ ?*` @2*  `c!,` @@&" 㿐N@!8N@    @ @ "` 2 N :  @9ƀ㿐 c8*  `    ,`*`+ * @ ?Е:    @L` &@ 㿐@R&@  "@ HJ "  "  "  " "x@?!'ܔܐ耢  / / / /@RJ  && @RD & & ** * * J 耢 ` g 䀢`"@%q  $ ` f@ɐ#( @%+f 0@U'   g@"!\ "  䀢 2& @"䀢 2 ` @`@#@g@a\@$  @#P@$D   @Qِ    , `2  4 &"b8@Wa & @Q,  &   &   @@ `, 4  @+)?3 ,` @' @$#h@6` @#cp`@& cx@# b@# `p /耢 2  % `@Q& a, "@$ +# ,   @'@$b& @$b㿐    2##@ "@"㿐 @@ "b8@@Vɔ w .` . . . .㿐2  @2  *@``?㿐 @" "b8p@V ` & & 㿐 ?& f#!,`"@$6  !, "@$+@ @㿈@.'㿐 ` f"b8@Vd"ʠ# h " #@ #   l " @    㿐@  !8@z ` ` ?@ "??    㿐!J 耢 cH” A $ 㿈`6 6  & @C耢 @+& @'㿐 6 @㿐  @㿐  @㿐F!Ā` @@  *@ *` *` *``  *@ *` *` *` 㿐@u& 㿐@` " `"b8@U#@װ @Ր㿐  @@c8@ @* `@2`c8 * `@2;&  @@ ,`@ &,`@" @Oے &@O@  && & @ @#8L & , ڲ L #M&L x( > * a7 "8c8*: @* ɖ@ #  * @a   * `#8* L* ?Ф   * `* ",`cȐ@W  `L ; ` *  ``` <cА@@  `L ; ` *  ``` >, P`cؐ@%  `L ; ` *  ``` &, 5`c@   `L ; ` *  ``` "`# c@  2L ; ` *  ``2 , L ;  ,*L @$ $ #` @TT!~&   @6 .`@&.` @"S  2@0B&  @,`@&,` @" @N &@N@x  && &  @n @& ` @6 .`@&.` @"  @Nz &@N`@O  && &  * `& J` !8 *J 2 㿐    "  "$+  €!  * : `5 !L*` € ~ ߐ ]y *:  =t >r /2p o *: `-g  ]`=`>`/2G[ *:  ' "  #`P@S"  G *+`@2,@ *+`@"9#`p@Sk"!-" #`@S`"& % -"   -2  -" #`@SC"A  -    8e"00/@/@0/@/@/@/@/@/@/@/@/@/@/@/@/@/@/@/@/@/@0/@/8/@/@/@/@/8/@/@/@/@/@//@/@/@/@/@/@/@/@/@/@/@/@/@/@/@/@/01010.//0l0001/008  :. J- >2$ J?-2  J?J?-2    " J->0 : J->2 J?-2   *J 㿐 &   ?#`@,@ߒ@  㽀'P'X'L'T` ''ؒؔ!"`"`"` "`"`' <@$@' '' Ͳ N !" /T `N  -N  -   '2 'ߐ ]  *:  = > /2 #8* @  * `@􀢠>rXk  ''ؐ' '* 8`@8 V* `@/* H* 8`@8 <* `@>/*: `>ߐ ]`=`>`/  ߐ ]  *:  = > /2  *8`@8 * `@ߐ ] *:  = > / *:  / > =nܰ * 8`@8 * `@*: "'20    N:`    >2 * ƪ T `$' !'* 8`@>#8 N * `@>2 v '쀢2\h "$@*.`@&.`@ .`@@K*`.`@Kg* /`@T* ' , $ S $ L$ $ '쀢   '? ؠ?@" "' 'P L€'-'(䀢 @'''' @ې㿐B FgaȦ "P +f)g`PD `  c x  " cP~ `Pc t   t    2PP$P Fc%!T , @ @MH!T , F"Ģ  @ !T@M<` (@㿐@=``)f#!,` !@ߔ  @<!Ȓ @ i @=Z 1#!,  !@ŔZ @B#f#,`  "@@=: ,  "0@@*8 @&#!,`@@"X@JJ & & && & & & & .` *   "@& `   & L /   &  "&" &&㿈F"Ķ'L@?     , * @2 ?2 `"xb@O!x J. '* `'- ` * @ ` 6 Fb@21`F"Ī 9* 5` F@@ 2 L" " `"` `"` ` @"` `- 㿈 !h@   @ 2 2$  `@  1 + !  @v 2  ` `b@d @^bȀ   $ 㿈!`   @@G   !`   @@3 `@  @&b؀ ` !x@    @ 2 2$   `   c8* `    .`+`** :`  ?K ;  8 * `@2  b8 Ux  `Rs  `LnK  =j  8* `@   * `@2   U  "N"    i   `?@b 9 !x  @  ` `$b@ 2N@ & % @z ,  @N@@a$ "&N@ h@Ep f!@#@ @i 0Cc!,   #@`'''' ''3gaP'܀ '2!   g!TX aP#\!, #0@j&Ԁ @@I㿈@E f!@#@ @ 0#!,` #@>  p #87$@   * `@8    * `@2  * `@ 8 * `@2 4 @Hf`Ѐ`  @?V@x@:w젒 @A H@@g@c@G "" " " " " "  " &` @IS㿈` !h@  ` @f 2 `2$`  `@      " "@ @>&@Gr&㿈` !p@  ` @( 2 `2$`  `@   q   "㿐gaP 2 "xb@L"B㿐g!P "g@g!T @㿐c`&@@  2k?  c8* `   * *`+ *  ?Е: N .2L?@ 8* `  * `2 N 27?@ 0?N8 * `"(?N  * `"!?N  `* `Б*А * * @ * *` N ?Ѐ  2?&@ &@ 㿐?  ` ?#hc@L  ` f#hc@K f#!,`#@@c 'J:?@4N $@  @  @ 2&@@@ڰ? "#hc@K @ ?!,` @\  㿐` @  2 N :" N "`  c8* `<  N+` N@ * *`Ѐ@ -2F  8* `$ &@ * `  +` *`+ *  ?Е: N /2$  8* `2&`   * `  +` *`+ *  ?Е: &` 㿐R ` %RC@@fc!, @ΐ #R` $$`!, @ X!R  #hc@K!   $ #hc@J!R 2 $$g 䀢` @㿐#R` 5R.` 2`@ 20 ߒ  )3R`=  1R! 2 @!fc!, !@k ` $`$&`!, !@] X 'L? ?'D'P#? c|"@"@`0` f#hc@J"f# ??c?' ""P  ??c @#@?P?㘒#"#'?' ?c?&` @#@  &@&`&`&` &`D"?c@@` ??_ .?# A  ?j c@@`?  'L@3 `O `"K 0I@%!?c@?@#` @~ Ra!,`! @L@ ?!0 a 2?a| ?c!8@"@?!@"`,   @  ?#`,aH@L ?#!X#?c!p@#@`  @G  ?#`ax@!<!< " !I@  ?#!<@ܐD@"  ?#"a@ՐD!?(#,# ''@"f  `'  '`#  @ @8D?c@@@%@P `؀ P`܀` P(, `@ D @={ D` @"?@F  ?D# a@p?#  !Ƞ!p gD bD`Ǯ ? !|`?! 1P!` "@< ?|"@D!?#|? #!b @f ?c|@#@?|@FH@CG ?|@ b@P D@Cl@@7DD :@/  ?#"?@@@D@ @   @`?@ސ?# ?c@@@@̐?@Ɛ?@@?# ?c@@@@ " @@ @?  ?#bX"!p?D# #\"!p#` #d!p#d"#h #l!p#l`#p!p#p?#t!p#t#x!p#x#|!p#|#!p#??##!p##!p#` #!p#?@.a,`"@@?@?# ?c@@@@@6 &&a|`"aa, @g"?|a|"?#|  ?c|@@ ,  @F" 6/@#@@@ @,` @/R` #Ra!R "`$ , a@ X 7@w#8P #`@ #h@ΐ L?c?@#@L? ##@#' '  #@'qcĮ?   7  ?c@? O@J`;p@ @2#x@ @Q `@K`@F@&!, @R` #Ra!R "`f$ !, a@X# @#p@ @#@@@U @ `@ `@@!, @vR` #Ra!R "`&$ !, a@_`X !!(  @@A`@@ -@ -@ 2D? &`J`2##@@A&`@?#J@ 2 @#@A&`a, a$  @֔0?# ` @͔0J !$  `@??2  2 `ږ  2 ``(4̖ ` 2 ``8` `  `H!` u!p` `XD܀ h?c  L`h퓖 XL@ ?#`탖  ?c CL ?? ?#??c`hg? @?c@&#@?# ?c ??#`0H  ?c `: @\  @Zp?`?`?#  ?#hc@Eu$ےc @"@?㌖ ?# . ??`{ "'@'` "`@` "`@{` "&`@u&`&`&`@Ra,  @R` 'R!R "`$ a, @ʐ X??@# Ȓ@ؐ ?c @? 50<#@ E  @5 5@ @Ð 0,a@H  ?J 8 * `@2ꀢ?# q"?# "8@ '8 cL "Ӏ 3,X?, ` L K"@ː!` @Đ!` @!(!p@ @a,  @GR` 'R!R "`$ a, @0 X?# `@` @ ?# a8@  aH@  LL #@ ?#@!d`7L 3 .`0@ "`0@a` '@ah "?`0@u@`0@@> `0"@`0ah ah@*@ * * * * *L@ "@?? "&```C!?#?>@<@!p@ː L&` &@`"# `@)`@$@,` @R` #Ra!R "`D$ , a@} X )`( 9@ؐ!`0@@9 ?# `@`@@ʐa,  @YR` 'R!R "` $ a, @B Xư (:&`#`?1ΐ# `@`@@a,  @R` 'R!R "`$ a, @ X /` ?# ??c@@ ' ?? ?#&` ML@ I?a$ 2E?@A" @ ?"`@@N@ ?@,"0?@@:"@ @ ? @"@@!@ɐ ?#bH@n ?#p@ ?# L@L@  +'&` `&@@@a,  @R` 'R!R "`1$ a, @j X * `2O``0@2@!8`"`0`0@,@`0``"P"X@ΐ M`0!@"`@@ @a,  @4R` 'R!R "`$ a, @ X` @   g!H`g!x" (@Ӑ@Ԑ@Ւ `- (  @{?c ?`` #`?#c #\@) +&` ?c@@`E@>,` @ΒR` 6#Ra2!R "`~$ , 'a@ X#@,` @R` #Ra!R "`\$ , a@ X `@?@_?`?&` "` @` ?  *㾠f#ap'X?'H` ''?''!g" 2atÐ$"at` #R` 2H" $`H"@@ *  @"h@b  '@1&'@1''c '@@ c ?`@#h@<@ @y"@@ڐ  '@8-@  'ca0 8 a4  @ bȒb `,@ `@ `*  `*  `* * * @0 '  0@ '`p ''  ' '  @*ܐ@; c`  @3Ԑ"В" ` ? /(  @"@= b@h@$c T`2``  ?' ' c `"'@ !g!@ǐ g!X@!@ @5B4@Z x  @s@t     "  @5+  @ʐ@4 `@̔  @ "  @5 @ 㿀`@ R!g!@z gaX@y@}@Ζ0? "! 3@9@``@耢  !g!@S gX@@n@l2!g!@? gX@@1& ̒%!@V㿐@TN` `c8N  * `@2  c8 * * `@2*:   #?#8@ L@ *  ``2`_"`-"`@ @c8@  @* `@2`@"\ L@ =`V G@% @c8@   @* `@2`  ?#`@,L J@ _ @ -2*``J@  _G 0*  [:`, * @ ? ??"  &@4&@@4& 㿀N䀢 % 쀢 [ !ha@9Y",* G`0`* ` @  @I @z@x0!g!@M!gX@@6 㿐@!8 o2 @` `n2@N` W @!8 `y@` `e !8` `s!8N` C !8 `1!8N` 2 8  o!8` `f !8` `f!8N` & n !8` @`o!8N`  !8 `0!gN`  !@!gX@> & 㿐? b @  @!8 2@N` !8x !8 o !8` @`n2 N` j  y!8` `e !8` `s!8N`  !8 `1!8N` 2 N  o!8` `f !8` `f!8N` < n !8` @`o!8N`  !8 `0N` b(% b(@ !8@ - !g` `1N` ?!@Q"0gX@ & 㿐 "R@aR!` N@ ~N` /@2=&@̐ x  @@     "` @2`@<`,@ J?`/"?N@N@ /"`@)@2N @= /, @& 㿈@b@   >@_  ?c8  ?* `@2?M ?!8 k"? m g% t %  %$?%L?%t?% c8* `@2  ?c8  ?* `@2?@f耢  ?D>@ 㿈@@@  c8@   * `@2@ !g!@e"gX@L !8 `"*` € ! !+!=F!H!!@  @c8@ @* `@2`@  c8@   * `@2@  @耢 "!g? D>8TTT,TTTT TTTTTTTTD㿐N@  f# "=$ @9$ @ f!g!@"gX@=' #  @## @ @11@$ @  *@   *  *@ 㿐f#! ,!@ $@А@$  c0@  (  c8@    2 !gc@@ݔ 2!g !@z#PgX@Ә L   @gc@ 2!g #"!"! 㿐M!@1ɐ ϐy @J  !g!@F!(gX@0@_㿐)G 0  [@:`, * @w ? @@? [ * !ha@6",@ 0*`   @ 㿐@ x  @@      @0r㿐g D @ 㿈耢  B&!g!@А"gX@) 㿈Ւ耢 !g@ >!@"gX@ 㿐N@ #@* @ "@`$ @J?`/"*? " @-&@1& 㿐@@@2 !g !@q"pgX@ʘ 㿐b@ & @@@ 2 !g!@N"pgX@ 㿐 @a@/& 㿐 2 @V@ J@ /"*@ 㿐N@  @)s@-0&@1I& 㿐f#Ɣ ?  0  "4"4 㿐g! >L ""H㿈쀢   f#4 `""0?"0","H 㿐@} f!g!@#gX@  # Ԁ @@/5$ ԰ 㿐f#Ԑd ?    4  "0 㿈耢  f:::  㿐N@ @̒ !g!@s#gX@̘ @.g"` 㿐 [( G!ha@4G",. `0`*` @     8+  (*Ї8    (@  "    '8J (@ #d Hd #dHd ƉB  .2 2     *J` : #㿐N#8``: ` * J  : * `@"*:  :2   @ `?㿐@{UbD 1 H % #R*` * " R* $   @$ $  a$* @*`"@*`@ @.$ B$ @ڔ,;$ HR*` * " * $   @@-`$@`@-`@$@*@$@,$N @ `%bD   % % 㿐@R!`  R!` g!> f   0#`3 0fc -c ) 0f#`# @TRa !HN@@c  @7@BN@  R@3 "a R!`p   R! g!R!`2  @ 75H "@?,   @-3& &+ L@ 5H@  @@N@ @ "@ R@װ 0 "a  㿀'L'P'T@ 'XR!`, "f     #`   fc c   f#`  ?'Lr 㿀g 'H'L'P'T`'X@R!`  ?'HS 㿐RH! `  R! g!`4?2UbD    4 'R$, * "*  " @S  4 `, "D , * "$* `@ @;@r㿐 @-#آg!@#UbH@Mc@R "a@ @@@9R "a@R"!㿐R!`  R! g! "R@-R"! 㿐H  R$ a  R!`  R! g! "&! @ &!  $ R 㿐H`  "`㿐 `#Ȓ#@R "ag@?`@_ gR!@"a@9 R "a㿐!R! R@R RR$!"a"$  "$ @m$ $  ?HU"`"DH` UR "`U H㿐@+ I@@% `g@X@ !g!x@T@!@O@"@J@ 0@E@ "@@@#x@;@#@6@!@1@#h@,@#@'! 8@ @ ! @`H@@@@ /!g $!X@ p$!X!%H'f+F/`5`u] 4*` €"       g"c!2!!!  !0g"L!@!PEao!`k 0g c#_!p[!W!/@K O!K!G!C#P?!;!7!3!/"+"I"@"!"@("@@""P@@#@@@   ! !##В`g"ɐ#g"#g" g"#g" |g"#ug"#ng"#gg"!`g"#@Yg" Rg"|!Kg"u Dg"n (=g"g 6g"` 8/g"Y#h(g"R H!g"K Xg"D hg"= x g"6 g"/ g"( g"!!g" g"!g"!ޒg"!@גgbҒg" ˒g" Ēg" g" g" g"L@` @* : `.)*`#x €!! !   !0 ``!Pa`@ߐ!!gL@@!X@ؐ `@!X@!(@А!0@!X@ L@  @`g"!XYg" Rg"|!hKg"u#Dg"n#=g"g#6g"`#/g"Y!x(g"R#P!g"K!g"D!@v `!g@H!X@E!(@m!0@@!X@Z  @Ҝ 2, "",h   4  "","0㸀?`?$㸀  "a0@8!@ @3 `g@X@ a0 a`@ "a@#!@@ `g@X@  㸐 L`2 " @ !g@!X@ `@!X@ؐ!(@!0@!X@   @"㸀 ,@  ԑ, ?# @`1Fa*`@@ 2$a*`@(_@ $!  &! H,`% K!, I""8_h `1 J@ -2 J` g!x$$ ` `"x"@Ő 㸀 $ @p @ @ @|h   |<   $  @q   @l  @i  @f @c  "`N13+ 'd` '`@!y@ "@@ @ @d` @_\!` !`@(d `!, "@Obd @dd " `@G@K b` "d@\d `@V@ 㸠 L  P@^XX` @"ؒ L `  `L 1gbb+@"@' 3gb@%a㸖!  _!! bb@`  @#(㸠@)aF !x`g" "AaD a` Xj @ ",` @`@,`@ Xxh´˜ˆHtĴ,HxĴĴ0@xÔðPĴ<XĴĴĴĴĴĴĴdĴĴ \@p`Ĵ ĴĴĴĴĴĴĴĴD`|\l|(Ĵ$@\Ĵ8TĴĴxpĴ <ĴĴĴĴĴXt(ȝ㿐  2#P#X#`@ @b  㿐@R㿐@[㿐@㿐$ $ 7 8 x"ch@ !?#* * 3 *  3  @#``*2  *2+    2 #` @0 **2 @ 2 &@ **2 @ 2 &` **2 @ 2 &` *2* @ 2 &` 'L@'L& L @?''''55ک@@(. 6  6 x@5-`'5:1@. 6 ( 6 V@@1 ) `''5 @. '6 ( 6 ۲@@0`(``@''50os@(. 6 @@@6 @@5 -`'5=_@@(. 6  6 @5-`'5@(. 6 @@ 6 @*@@ 1 ) `'5* @(. 6  6 @@0`(``@'5?Q@(. 6 @6 @ 5 -`'5`&@@(. 6  6 ز@ 5-`'5"=@(. 6  6 @@1 ) `'5?@(. 6 @@ 6 @@@ 0`(``@'5"W5@(. 6 @6 @ 5 -`'5@@(. 6 @@ 6 @"@5-`'5?f@(. 6  6 @@1 ) `'5)P@(. 6  6 @@0`(``@'5m@(. 6 @6 !@5 -`'= b@5-0,@@1 )   Q @0`(`@:m@ 㪄5 -5Ą ]@ 5-@S 1 ) 6(y ⁄@0`(`@9@ Ȅ5 -xs @5-0@ք1 ) =5C ᇄ@0`(`@V@  5 -*x @5-?;@1 )  ل @0`(`@#J@ 5 -?B 5-!}⁄ 1 ) gX" @0`(`@?yN@ 5 -)/D5-㩄1 ) =҄` @0`(`@/@p 5 - &߄Ƅ5-:I1 ) 5;̄@0`(`@"@5 -6u495-91 ) 蟄@0`(`@1+@e5 -= H5D@5-ʿ5㗄 1 ) *1㧄@0`(`@?$0@9 5 -Vք5Ä@5-#351 ) ?1} @0`(`@!a0@ф5 -5O@ 5-?951 ) (P1@0`(`@0@ᡄ5 -=߄5₄@5-/N55 1 )  1⻄@0`(`@:ᴄ0@㑄5 -@@ HL  H;j&. ㉒`v"" " " " " " 㿐`  "8@ @Δ@@@& @ ?`@&&@`@`?`@&@?# * *2 2 "@` **2  2 "`` **2  2 "`` *2*  2 "` g T`k!U"L "%g$ $Ā`$"L@G  ?#`㰒c@E@4@h @J$Ā`C@   ;   " @= 2 @`"  @  "" !&&@  &@ Ā  2   &@` &㿈c''@֐  !g!@#gaX@@@j  0   c8L@  * `@2`  @"  :   c8L@  * `@2`L@ #  "   `*@`J@ 2 `#8  ` `*@`J@ 2 ` L@  @` "\ ` * `@怢\`   `*@`J@ 2 `L@  ,@`L!x.  €쀢 @ >"`<#쀤    @8@6 @4  $$ @ Z $$ $ $ %%@ "@쀢 @ {"`#쀢  #쀢   !g!@ݐ gX@5 Z `@ɐ R `H@  쀤    @@ @  $$ @ $$ $ $ %.%c@ & c@  `P@  c@ !g !@ XgX@טL@  * @@^ 2M@@쀤    @@ @~  $$ @ $$ $ $ %%@m'耢  ' " 쀢''h㿐    @L  "@F @@@> 2 㿐@d   << $  < < X$f#!X!T@@@`c: @"B $ @  ࠘I  `c: @ @f#1' @j!\     &@ @$ !X @ & $  `@$ @o$ 㿈f#!T!X@7  ?a& )'%7  c  @! &#:  c @a\  9  6  `& aX@5@1 @ @& ` & &  @'!( F ąB'  ? @  >  "&  㿈f#!T!X@y   c  @ &#:  c aX6  +\@ # Œ` ’`X &\ `"  @ @  '!8'a F 셠 ‰D'L @s  @ @2 @o$  ?!!? @j * > a0w  @ߐ㿐 gN  g! =a@@ fc$ % 2aH@ fc  0aP@ܐ fc@   0aX@А  !gfc  "aX"aT "a\!@u!`@є㿀''  @@ |@ $` &  " ?ဦ$   -''DƅB'd c `@#/"a@l` !Ȑ!.@ .` .` .`  .` Д.@ .` .` .``!  U'''ȍ ȅF FB'D'  `@""@   [ `@"ߔ".@`" `!  +.@?`   =.@?` >.@`&@   ] .@`&@ &.@ ].@4`2!. @Y@6"@`"  [.@ `! < =` >   .@ .@2.@.@ ` ].@ ` & "@@@&@`" ' ؐ@'‰B?@ 8I"H*` ?b(@@@ 88.@ .` .` .` .` .` .` .` .` .` .` `   ]Ⰱ V@ 耢    "@' > FąB'& @ؒ.@.@ђ <@ @: .@ .@ ` @@ *.@.@㿐@L"Ѐ  @~b؀ gU "bTg `Ug@!@e  8@~b 2UbT -  Ib x@~ɒ : &@~ )U@~ 2 %"P %bT `@0 @~p@`,I""D㿐I"@~ : "  @~j @~    㿐I " x@~x : $@~L )U+U@~n 2`%"P %bT ` @0`@~U  X㿐U"X`4+UU"T`. I b x@~: : $@~ +U@~1 2`%T %bP `" %X@%X`@}%XbP`€㿐U"P`㿐U"P`   㿐@h`,I""Dc@~ 㿐@  @} 4IbD?&& @& & a<     @S 㿈    &  4& @NI"D "  @& &   ?腡"聨`ߔ@! > 㿐   @@ 4&  ʔ @  a0 @}S @}Q㿐 bې  ؒ ;`` $$ ؄ % )#  $ ((@ x`F #` $(` #` $("@ $ ؇("``FB#` ؆#` $; Є# # $# $# "" "8@ ?"㿐  &  & 4&  @ .@㿐`  8 @|"@$$ " "㿐 `@ 'Ԑ "` '!@4#Xސ  @Ɛ $$$$ Ķ Ժ@@    * $ $$ $ $    $$ fc,   " , #  2"  $$Ԑ@ '耒 /g" q"2  l)؀ h) %   $$ 2 ' ' $#a, #8 a, # @|  =!g" "%[ "@j', #hyȀ>g" 9@耢 23 2''&̒@'&Ȁ  耢  ؀`"  " 䀢  Ԓ@\  @~@{䀤# , !h  `2#  /Ӓ#a, `,# z'd` ܀ @  h@   #Ȓc@L!T OӀ2  "JԐ@ @@@@Ȑ4  @  c , & & && &    $$ #!, 뾐!, "  2"  $$@2@@ ##!` 2 !,耢 5@ 0!,  !``  @ P냐 ` @zߐ p@zې = @z耢  @z@z /<@z̀ "@z耢 "@z)%     $$?' '$#a, #8: a, 3 @z   @z"@z @zԀ @[@#aa g"a "   ` 6؀`  "㿈f#a,` @P "  a,  @   2a,`|  a, ѐ!ݐ`$  2   a, 꾐!0ʐƞ  㸐!,`감!``( ", @G "& @zO 2   @2ah "  2  2 @ 2 a,  ! `d 2 `` " $ @ْ  2  $a, { !J@ " @  `,?& @ $ 2  !,`^ $!MY@` ` `@y   a, E "4`@㸐!`1 0 @ 2 @2쀢 " @@y "H@  @  @ !,`"P@A 㸐!,`"  !,` " 㿐@ o  #Ȓc@-"[@ b  #Ȓc@!"^@ $ $ $ $ $ $ $ $@@@y>  g 䀢`"魒㿐  ,    @ 2 ?` , @L*     @  " @ """  `  # c@H@Ŕ @x & & &p''@ 'Ԭ  $$ R$ f #c8  @y% `* `@#8 :3* `@2 :*N #%#8" J * `@"J #2 * `@ #8 * `@2 * N# c@X@X!#8 *   :!N *  ``2 -"  * `@ #8   * `@2   :a,N :  a, #h͒ #* `@ #8  * `@2    * ` 3`c@xM +`&܀ ؒ&܀` N@ *`''؀`2 &c@x/  2&&$@$@؀  'n '`c@x  `܀ Xؒ@ N@ /"` @͒'''   8$`+*`,$ 2?a,c@w  27a,܀ 1@`?@J@ /"` @'''   $`*`$ $  * @ @*`$ *`  *  "?"?"? #Ԁ " ]0   *@  @ȓ*`$ $ 㿐8O@b /`]%)8O  ."/` (  @4@?Єɇ(.8 @ @Ɇ(8//` /`8%(8N` .") `(` @4@?Єɇ(.8 @ @Ɇ(8/") `) /`  ` 㿐@w@8 ?#`@w# :,@@ @x!U"\ a $"\"\  "\e 0"\@F]㿐@v@ ?#`@v :,@@ @FUb\  㿐@ " ! @0 @v#@v  㿐 ")  @6$ f#'+)   " , ` ` (0`@  㿐`8@ O@vL H    &@@?@vc "  "@ " "@vZ&@ "`?㿐!U"\ ƒa ?"\$"\㿐@vC@ 6 ` ` @v9@@ ` @v/@v- 㿈fxf' ؞cx F @"x&?'E ? F&?'  , 7 xp0/,  g? D`@?腠B' B'@@v @K?x: >@$x@x:㿈\@f&#  ?耢` ' `+@2(!  #U@u@&b`   "` @u` U?  ! fx  :"x@! &f#!U@ui@u` ` 2.?@ېa ?3&q``'"`"`- 4ϒ ?&? \ ` `:@㿀'D    '@}D&`2'@@ !@ !p H@u 2'g ''@B `+ @覒 2@tɐ!@ }' 0`@@t! @ @tԐ`f#"!"!|ް 4  `  `ջ"!f#  $ Ȕ$  `  @9  '`@ L``䀢  !(aH@P!ʀ "@t@ W@ty'@x蠒 #@ ap䪐 @ @td@tbl`@t^ @ '@t2! 䔐 @ @ @tL@tJ䀥`f#"!"!|T %@t@@ `>f#!| !"!|6"!`` ` " @sD "%D `M`'@ @t @ Ð   &@tg2&@sgaH "aH`f#"!"!|㿀` Ȱ  "&`m%g' '쀢 `'f#aa  @ c cS 6c `  "   쀢`)ca` &@ !a, ""@st"H֐ @s쀢 " @sl@sp ɒX ?'耢 "@s~쀢 "@sx   &@l㿈Ibh fo"bh#!" B c'셠 @t?0Y" B"ȁ'BĤc" BH  " B"ȁ7ąB' B'@@s 0,@?$%F@?,    "㈘?" B"ȁ7ąB' B'@s f#@a8@r ?#`#`@s6h 2 a8|<  !a8`+bР@rߐ@rڐ@rԒ`bА@rΖ @rȒ㿐f# `  @ ̀ 2 ' "  ` ` "؀`"@s  L@ @I  !e"x@r$,#㿈  @'?e "`!! I"X*` "`@rs 㿈''"#"  !(aHP@!# B!(aH`@!$#'@'#D# &# 9# B # 9#( B #0 B &㿐@q"h@q"xᜐ 㿐   @  @q@q 2㿐`l`? 㿐O@78N@%@)/@N` "%/@N`` #8.(쀦 @4 ?Єɇ() 8 @4  Ʉ/@``N@Ѻ`/@㿐K  #H @ @2 K   #6@2 @K  #H`H % ` @ 2`* `* ** K  "" * ``@$ ρ㿐K@ @ G "8cH#%2, K`c8 + a+  `* a$ `@4@ А?ɓ* *: @4  @ɐ@    "   `   ` `"*``K@  @ #@#@* @@)`K@ p @"8cH H%2- K` #8( !+  `* a$ `@4А?ɓ* *: @4  ɐ@    "   `   ` `" @ `"' @)K@ % `2 +   `+  K` @ ?В  ?K`@*  ɐ@ *`+` K@  @# + ``@F!J@ #8(2 `-+` `J@8J@  (2` -"` +"` :`?㿐А D L@L  : /2 2L4 :( c8*  `   * `J / @p@ B `@p$@ / *`@p@ 4 `@pxI"l @ 'D'H ''ܦ  @@oD@p 2`    @   D D- @*`l@o `@p "  J@ @ "@L  [' ' '   @oݒ ]   a@pp @o  l@*` M@:$ `a@pX @o @ #8J * @`,* ?Д  L / a@p2 @oj@L ; ? a@p 2'@oW'L ?2L a@p 2'@oF'䀥' L #2 L @o7@'L   ``@##?쀤  :@oQ$@  @  +''ܒ@ "&  m @ + 0& && & & & & & & & $& (@ & ,& & & (ܠ & ,@ Ɛ@W&   $@  J  #8a8*@`"  *J  @ & @ & `@ & `    @ D@9 &D@n02&@ & DH@nH 2" 㿐   @n   " @n}   @nv @    @nl /,@n@ " @n] ;,@`@np@  " ,@nN ?,@`@nc,㿐@n<    M  /J@ % @J` 22 *J` F2**`*`J@ * $ q M @ n@n@n @ 0 @n / ,@n, & @m $@@m@m@y &@mN`/J /2 J /- @ @nh |<  g@m  䀢`"+@m@  !@m"0@m @m㿐f#!`  ! 2`&@  ?#`@m.@@mK  "8 @ 2  K  #.  @   * `$ @ &` @ &  @mt2K  "8`H % ` 2` ** `* * K   ""  ``8@%Ɛ&hf# D''䀤#'@m    *`$ $`@ `@ ?@$@@m@'`0 `< 耢 'I     *`$ $ @ `@ $ /*  ' @l͐    *`$ $ @ `@ $@l͐ l*` *  @ E' @Ȓa  + :     *`$ $ @ `@ $* `@l'    *`$ $ @ `@ $@l@' 8+  ?&`#耢  /   *`$ $ @ `"@ ~$*@  '@lX / Ӑ耢 " $     *`$ $ @ `@ U$ /*  ' $J@  #X@l@_   N 2`'!` @ ?     *`$ $ @ `@ $* `@k'@/     *`$ $ @ `"@$* @ `'  0 0  @  @   @  "@k㿐N /" @k R@L . L  / `. `.`/L  .`/L  / `/@  @(ߠ L /2٠ @ՠ  @    `L /2  ƀ `   ,@  `L /  ,@ `2,@@@ 㿐 ch@k @k@kN@  ?@l #$@1`@k Z /@k% # "@j"2N@N` /2N@$ /@k J` /" 0" /<    /@k $  ` `J` /`` ``` ```` ````2 &@ڐ` @jǔ@jÔ3. J@ / @8J@   J :J /2  "@` @j  /* @j.㿐 I*@ "l*`       @j`    " @jY`  `@jR``   ``p@ ' (    ,` #    @jV : 2 @j*@j' @   @ @ @ @j @j  @0@j@j@@i@j  :,@i@j @, [,@i  @i ],  :, @A  @iĐ /,@iה@ " @i ;,@`@iȔ@  " @i ?,@`@i,$  ``@ W'  (@i  ,@ix㿐 Δ 㿐  I ``@ /$. b@i;@ 㿐@iZ @& 㿐@iP $@& $㿐@iF @iD @iB  " @i<  " @i6  " (@i0 ( " ,@i* , @i$@i" @i  $@i㿐I"l @ "  ` @@i@i( 2`    @  * Il(I* l(  `?㿐@iq / 2@<!&@@&@ @3&@㿐 " N  #8  /3g 95 `,2C @iz @iy  & @h㰒aX #@hi @ih`   @hn㰒aX ϖ@hX @h,$ $ * `@ `#8 * `@2 N @i5@i4 `2&!#٩ @h6#gaXؖ @h @i  !#ٕ @h"#gaX؂ @h  @h\,$@" 㿐f#`H`  @ $`H @h @hː (@g @g 0@hɒ@g X@h`H@gܐ @h#%g`h`@hݐ! @hא@hӔ 㿐@g ?#`@h .@,@  @a@h  @h !## @g#gaX @g 㿐 @g̐  ?#`@gȐL@`/  /`? L@  /2 L@ " ,@@h  @h!,@㿐@h& / "@ho 1!#֐ @gc#gaXÐ @gL @g@hI  2!#ؿ @gL#gaX׬ @g5 @g /. @gh㿐@g`  fN N /2N /``X``\  @   `\@ `?@    @ `?㿐`fN /" f# d <&` J@ /`?J@@ N 2JJ`J @"J "  @ ֒@gE  2  c@ c ` :&` J@ /`?J@@ N 2JJ`J @"J "  @ ֒@g  2    㿐.@ @f  "@f@f   N@L@ @?@fL     㿐@fj  N  /N / .2N  .` !@fr a@fl 2L   @fb    㿐@g R  R!#u @f#gaXb @e -)+g,@f @fߐ  W @e#aX F@eϐ $@f  `@e@@J?` ڀ ` `@e @ @f @f !#  @e#gaX  @e N -  N   g@f!h @f ` @f~ 2!# @e#gaX @ej @fXh   $   @fz ? $ @ej $ y$ @fP" "!#Ɛ @eS#gaXճ @e< $+')g > @$  . @f, @f+ 2 $֣ @e1㰒!X Ւc@e  & @e6@   $ +2 @e   `" @e @e 2$!#p @d#gaX] @d  $ 2@d@e @e 㿐 `A?@ 9    *`2 @ * , @`2 *`  @e @e !#$ @d#gaX @d  *@d@dƐ` @eOf#`-.#`@d@e/     ,@ `L   ,@e  2 `" ,@`  ,@`L `,@#㿐`  @  -a @d@d|,  ` `c`0c @e 0+ @d dy 0c@)a@d#g 0"@'А@dcU 0?@#&%@dޒ"C 0b@%}x@dՒ@1 0@1沐@d̒b 0!@@dĒ 0@d" 0,@d"@d 0 ,@d@db 0 ,@db@d@ 0 ,@d|@@d" 0 ,@ds"@dc 0 ,@djc@d# 0 ,@da#@d d 0 ,@dX d@dy  0 ,@dO   0, ,㿐N  *:  & < > " ` `2 ` N` @d` !# @c#gaX @cl NO * : `Dِ!ē*` € &* a* m* p*2 ; &*N < g l*@ t*" ; &* q* u* o* t* ; &* #* 3* 2* ;* N * e`eeeeedeeeeeeeeeeeeeeeeeeeeededܝ㿈!f" @cL @d $"@d'a0"H !(DB'@c6 @c $"@c'" !0H!(DB'@c  @c $"@c'!8!0a@D!(HB!0  ̉F@㿐@c !# @b#gaX @b 㿐 @c @c !# @b#gaX @bp 㿐@c| !# @bq#gaXѐ @bZ 㿈@b?'@b1f"  c@b0f"*"㿀@b?'@b 1f "  c l#\#`@bk0f"*"㿐@c1 2N!#Ә @b%#gaX҅ @b   !8 *J 2 J  *`8(8 " J  㿐&@@b` !#_ @a#gaXL @aՐ @b&.JJ`" JJ@" J`?㿈''@b耢? !@aŠ @a! @b-h   |< ( g 䀢` A@a  @a @a@a 㿐@b 82 @ah   |<  @ 㿐@a`   @b @b@a0?㿐@bb `@b^ 2!#Ő @aR#gaXѲ @a; u㿐@al  N  /N / .2N .`  㿐@aQ@aN/ -8 NN@ @(8 $? "8 NN@ @"8 @a4@a1a8 ?  8 @ @ @ "8 `?J(8*?[]  J  㿐  @a 0@`@`㿐   @`  @`ݐ㿐@a  2!# @`#gaX  @` @a 2$!#  @`#gaX @` `$  ` "&    2 & 㿐@ak  !# @`n#gaXΐ @`W @af 2&!#͐ @`Z#gaXк @`C &    " 2 㿐 " @`: 2   2 㿐  @`O @`M 2㿐 @a 2!#ф @`#gaXq @_ 㿐o㿐ݐc\ 㿐ݐcp xؒOf`-#.#@`@`~  @   `,@ L   ,@`^  2  " , `, L ,#㿐    @`f 4 㿐@`  !#  @_#gaX @_ 㿐@`~  !# @_#gaX @_k @ 㿐@_㿐@`   > > 㿈 @`!  " ' ƒ" ' FDB 9> *&& > +> 㿈g `  g@_!`h@`\耢  㿈!f" @_s @`7 $"@`6''aDFB'x?!'L B'PƀC ݒc@_ f"@`&   @_ْ 4 B!  ?腠''?؀`…FB''쀢  ' @` L @P@^  ??@_  @_ @^"㿐@^ 㿐@^ې@^ِ 㿐  f!Hahp@'"@_֒? @ @  @ @㿘 @_˜?K@^ ' b x |  x@^{" ?@?@^m" ?@_@^2@^]" ? ?# @M  @^M@^H x" ? @_s @_r @_q @_p @_o㿠 .@_m㿠 .@_k㿠 .@_i㿠 .@_g㿠 .@_e㿠 .@_c @_b @_a @_` @__ @_1 @_0 @_2 @_9 @_: @_8 @_=@Q!?!@] "' ' t@_. <@] C      C J Z@] {" @_? @  @] {" @_?@] @^   &@^@] " ?@] @^ 㿠 m khe J XI.b @^& I. b  @^9    ) @]T2  2  @]K $  @]E2`2 2!!@]8 2`2@]-22  `2  @^@]  x"  @] x"  㿐/\㘐  @]d@]t@]㿐/\H  ??㿐㿠r㿠qUnable to convert `%s' to a bind address. Reverting to ANY. %s:%u: failed assertion `%s' connect.cconnection_host_name == NULLconnection_host_name != NULLConnecting to %s[%s]:%hu... Connecting to %s:%hu... Closing fd %d connected. Created socket %d. failed: %s. Master socket fd %d bound. using port %i. Created socket fd %d. A.A.A.A.Apparently %s has been removed. Scanning %s (from %s) will convert url %s to local %s will convert url %s to complete Converted %d files in %.2f seconds. @@Converting %s... nothing to do. Cannot convert links in %s: %s Unable to delete `%s': %s wbSomething strange is going on. Please investigate.Skipping %s at position %d. TO_RELATIVE: %s to %s at position %d in %s. TO_COMPLETE: to %s at position %d in %s. %d-%d %s:%u: failed assertion `%s' convert.c*s1 != '/'../orig.origCannot back up %s as %s: %s %d; URL=%sto - newname == fsqlen/index.htmlfile != NULLDeleted old cookie (to be replaced.) Stored cookie %s %d%s %s %s %d %s %s %s (ANY)permanentnonpermanent%s:%u: failed assertion `%s' cookies.cres != 0Discarded old cookie. name_b != NULL && name_e != NULLdomainpathexpiresmax-age%lfsecureError in Set-Cookie, field `%s'Syntax error in Set-Cookie: %s at position %d. cdm: 1 2 3 4 5 6.int.mil.gov.org.net.edu.com 7 8Cookie coming from %s attempted to set domain to %s Attempt to fake the path: %s, %s ocnt == countCookie: pos == result_sizerCannot open cookies file `%s': %s TRUE?:%d %s %s %s %.0f %s %s FALSESaving cookies to %s. w# HTTP cookie file. # Generated by Wget on %s. # Edit at your own risk. Error writing to `%s': %s Error closing `%s': %s Done saving cookies. byte%s:%u: failed assertion `%s' ftp.ccon != NULLcon->target != NULL!((cmd & DO_LIST) && (cmd & DO_RETR))(cmd & (DO_LIST | DO_CWD | DO_RETR | DO_LOGIN)) != 0user && passwd%s@%sLogging in as %s ... Error in server response, closing control connection. Closing fd %d Error in server greeting. Write failed, closing control connection. The server refuses login. Login incorrect. Logged in! ==> SYST ... Server error, can't determine system type. done. ==> PWD ... /Initial VMS directory not in the form [...]! Preprocessing the initial VMS directory old = '%s' new = '%s' done. ==> TYPE %c ... Unknown type `%c', closing control connection. done. ==> CWD not needed. changing working directory Prepended initial PWD to relative path: pwd: '%s' old: '%s' new: '%s' *ntarget == '/'Changed file name to VMS syntax: Unix: '%s' VMS: '%s' ==> CWD %s ... No such directory `%s'. ==> CWD not required. ==> SIZE %s ... ==> PASV ... Cannot initiate PASV transfer. Cannot parse PASV response. couldn't connect to %s:%hu: %s ==> PORT ... socket: %s Bind error (%s). Invalid PORT. ==> REST %ld ... REST failed; will not truncate `%s'. REST failed, starting from scratch. ==> RETR %s ... No such file `%s'. ==> LIST ... No such file or directory `%s'. .Lying FTP server found, adjusting. accept: %s abwb%s: %s Length: %s [%s to go] (unauthoritative) %s: %s, closing control connection. %s (%s) - Data connection: %s; %s (%s) - Control connection closed. Data transfer aborted. r%s File `%s' already there, not retrieving. (try:%2d)--%s-- %s %s => `%s' %s (%s) - `%s' saved [%ld] %s URL: %s [%ld] -> "%s" [%d] Removing file due to --delete-after in ftp_loop_internal(): Removing %s. unlink: %s .listingUsing `%s' as listing tmp file. Removed `%s'. Recursion depth %d exceeded max. depth %d. f != NULLRemote file no newer than local file `%s' -- not retrieving. Remote file is newer than local file `%s' -- retrieving. The sizes do not match (local %ld) -- retrieving. Invalid name of the symlink, skipping. Already have correct symlink %s -> %s Creating symlink %s -> %s symlink: %s Skipping directory `%s'. %s: unknown/unsupported file type. %s: corrupt time-stamp. Unrecognized permissions for %s. Will not retrieve dirs since depth is %d (max %d). %s%s%s/%sComposing new CWD relative to the initial directory. odir = '%s' f->name = '%s' newdir = '%s' Not descending to `%s' as it is excluded/not-included. ../Rejecting `%s'. No matches on pattern `%s'. Wrote HTML-ized index to `%s' [%ld]. Wrote HTML-ized index to `%s'. %s %s%s%s PASS--> %s --> PASS Turtle Power! --> %s USER331 opiekey 331 s/key %d,%d,%d,%d,%d,%dPORTPASVTYPECWDRESTRETRLISTSYSTVMSUNIXWINDOWS_NTMACOSOS/400PWD"SIZEtype=DecNovOctSepAugJulJunMayAprMarFebJanrb%s: %s total PLAINFILE; DIRECTORY; SYMLINK; UNKNOWN; implicit perms %0o; perms %0o; month: %s; day: %d; year: %d (no tm); time: %02d:%02d:%02d (no yr); -> link to: %s ... Ignoring `.' and `..'; trailing `/' on dir. trailing `@' on link. trailing `*' on exec. Skipping. Name: '%s' -:MYYYY/MM/DD HH:MM - %d/%02d/%02d %02d:%02d Timestamp: %ld Directory File, size %ld bytes wrong VMS permissons! DECNOVOCTSEPAUGJULJUNMAYAPRMARFEBJANfile name: '%s' .DIRFile Getting additional line empty line read, leaving listing parser confusing VMS listing item, leaving listing parser second token: '%s' day: '%s' nonsense in VMS listing, skipping this line date parsed YYYY/MM/DD HH:MM:SS - %d/%02d/%02d %02d:%02d:%02d ,)confusing VMS permissions, skipping line permissions: %s -> 0%o Unsupported listing type, trying Unix listing parser. wb%s%s%s@ ���Index of /%s on %s:%d��� 

  %d %s %02d %02d:%02d         time unknown       File        Directory   Link        Not sure    %s  (%s bytes)-> %s(nil)
store is `%s' POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument );Ok[WQ  /?"!,i9Ka~֝jבe  7CA f!*7ΑH^P}zdK5 _U^/%=kO[G)6F\I (QۚK5ަ5)n>5#F[uvT~>Qw???????%s %s:%u: failed assertion `%s' host.cindex >= al->faulty && index < al->countindex == al->faultycount > 0Releasing %p (new refcount %d). Deleting unused %p. Caching %s => %s Found %s in host_name_addresses_map (%p) Resolving %s... failed: %s. failed: timed out. %s, , ...u->host != NULLHost not foundUnknown erroral->refcount == 1ltgtampquotnbsp%s:%u: failed assertion `%s' html-parse.cto - (pool->contents + pool->tail) <= end - begch == '\'' || ch == 0x22ch == quote_charch == '-'thtdtablescriptoverlaymetalinklayerinputimgiframeframeformfigembedbodybgsoundbaseareaappletalowsrcbackgroundsrccodehrefactioncontentnamehttp-equivrel%s: no base, merge will use "%s". %s: Cannot resolve incomplete link %s. %s: link "%s" doesn't parse. %s: merge("%s", "%s") -> %s %s: merged link "%s" doesn't parse. appending "%s" to urlpos. %s:%u: failed assertion `%s' html-url.cfirst != -1stylesheetshortcut iconrefreshrobotsnonenofollowt != NULL%s: %s Loaded %s (size %ld). no-follow in %s: %d %s: Invalid URL %s: %s HTTP/%s:%u: failed assertion `%s' http.csock > -1 || ssl != NULLsock == -1 || ssl == NULL[writing POST file %s ... rbwritten == promised_sizedone] bytesnoneKeep-Alivewget_cookie_jar != NULLInvalidating fd %d from further reuse. Closing fd %d pc_last_host_ip == NULLpc_last_host_ip != NULLRegistered fd %d for persistent reuse. *hs->local_file != NULLReusing connection to %s:%hu. Reusing fd %d. HEADPOSTGETReferer: %s Pragma: no-cache Range: bytes=%ld- Wget/%sAuthorizationProxy-Authorization:%dConnection: Keep-Alive Content-Type: application/x-www-form-urlencoded POST data file missing: %s Content-Length: %ld %s %s HTTP/1.0 User-Agent: %s Host: %s%s%s%s Accept: %s %s%s%s%s%s%s%s%s%s%s []*/*---request begin--- %s[POST data: %s] ---request end--- Failed writing HTTP request: %s. %s request sent, awaiting response... ProxyHTTP End of file while parsing headers. Read error (%s) in headers. No data receivedMalformed status line(no description) %2d %s%2d %sContent-LengthContent-TypeLocationLast-ModifiedSet-CookieWWW-AuthenticateAccept-RangesContent-RangeConnectioninhibit_keep_alive == 0Authorization failed. Unknown authentication scheme. BasicLocation: %s%s unspecified [following]text/htmlapplication/xhtml+xml.htm.html The file is already fully retrieved; nothing to do. Continued download failed on this file, which conflicts with `-c'. Refusing to truncate existing file `%s'. Length: (%s to go)ignored [%s] abwb%s: %s Warning: wildcards not supported in HTTP. File `%s' already there, will not retrieve. .orig (try:%2d)--%s-- %s %s => `%s' Cannot write to `%s' (%s). Unable to establish SSL connection. ERROR: Redirection (%d) without location. %s: %s ERROR %d: %s. Last-modified header missing -- time-stamps turned off. Last-modified header invalid -- time-stamp ignored. Server file no newer than local file `%s' -- not retrieving. The sizes do not match (local %ld) -- retrieving. Remote file is newer, retrieving. %d %s %s (%s) - `%s' saved [%ld/%ld] %s URL:%s [%ld/%ld] -> "%s" [%d] %s (%s) - `%s' saved [%ld] %s URL:%s [%ld] -> "%s" [%d] %s (%s) - Connection closed at byte %ld. %s (%s) - `%s' saved [%ld/%ld]) %s (%s) - Connection closed at byte %ld/%ld. %s (%s) - Read error at byte %ld (%s).%s (%s) - Read error at byte %ld/%ld (%s). %a %b %d %T %Y%a, %d-%b-%Y %T%A, %d-%b-%y %T%a, %d %b %Y %T%s:%s%s: Basic %s 0123456789abcdefnonceopaquerealm:Authorization: Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", opaque="" DigestNTLMwaitretrywaitverboseuseragentuseproxytriestimestampingtimeoutstrictcommentsspiderspanhostsserverresponsesaveheaderssavecookiesrobotsretryconnrefusedretrsymlinksrestrictfilenamesremovelistingrelativeonlyrejectrefererrecursivereclevelreadtimeoutrandomwaitquotaquietproxyuserproxypasswdprogresspostfilepostdatapasswdpassiveftppagerequisitesoutputdocumentnumtriesnoproxynoparentnoclobbernetrcmirrorloginlogfileloadcookieslimitratekilllongerinputincludedirectoriesignoretagsignorelengthhttpuserhttpsproxyhttpproxyhttppasswdhttpkeepalivehtmlifyhtmlextensionheaderglobftpproxyforcehtmlfollowtagsfollowftpexcludedomainsexcludedirectoriesdotstyledotspacingdotsinlinedotbytesdomainsdnstimeoutdnscachedirstructdirprefixdeleteafterdebugcutdirscookiesconvertlinkscontinueconnecttimeoutcachebindaddressbasebackupsbackupconvertedbackgroundalwaysrestaddhostdiracceptanonymous-wget@no_proxyHOMEWGETRC%s: WGETRC points to %s, which doesn't exist. %s/.wgetrcrb%s: Cannot read %s (%s). %s: Error in %s at line %d. /usr/local/etc/wgetrc%s: Warning: Both system and user wgetrc point to `%s'. %s:%u: failed assertion `%s' init.c0 <= comind && comind < countof (commands)%s: Invalid --execute command `%s' %s: %s: Invalid boolean `%s', use `on' or `off'. alwaysnever%s: %s: Invalid boolean `%s', use always, on, off, or never. %s: %s: Invalid number `%s'. inf%s: %s: Invalid byte value `%s' %s: %s: Invalid time period `%s' %s: %s: Invalid header `%s'. %s: %s: Invalid progress type `%s'. unixwindowsnocontrol%s: %s: Invalid restriction `%s', use `unix' or `windows'. %s: %s: Invalid value `%s'. ?@$awwget-log %s received, redirecting output to `%s'. %s: %s; disabling logging. wget/usr/local/share/localeUsage: %s [OPTION]... [URL]... GNU Wget %s, a non-interactive network retriever. Mandatory arguments to long options are mandatory for short options too. Startup: -V, --version display the version of Wget and exit. -h, --help print this help. -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. Logging and input file: -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print debug output. -q, --quiet quiet (no output). -v, --verbose be verbose (this is the default). -nv, --non-verbose turn off verboseness, without being quiet. -i, --input-file=FILE download URLs found in FILE. -F, --force-html treat input file as HTML. -B, --base=URL prepends URL to relative links in -F -i file. Download: -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). --retry-connrefused retry even if connection is refused. -O --output-document=FILE write documents to FILE. -nc, --no-clobber don't clobber existing files or use .# suffixes. -c, --continue resume getting a partially-downloaded file. --progress=TYPE select progress gauge type. -N, --timestamping don't re-retrieve files unless newer than local. -S, --server-response print server response. --spider don't download anything. -T, --timeout=SECONDS set all timeout values to SECONDS. --dns-timeout=SECS set the DNS lookup timeout to SECS. --connect-timeout=SECS set the connect timeout to SECS. --read-timeout=SECS set the read timeout to SECS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1...SECONDS between retries of a retrieval. --random-wait wait from 0...2*WAIT secs between retrievals. -Y, --proxy=on/off turn proxy on or off. -Q, --quota=NUMBER set retrieval quota to NUMBER. --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. --limit-rate=RATE limit download rate to RATE. --dns-cache=off disable caching DNS lookups. --restrict-file-names=OS restrict chars in file names to ones OS allows. Directories: -nd, --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. HTTP options: --http-user=USER set http user to USER. --http-passwd=PASS set http password to PASS. -C, --cache=on/off (dis)allow server-cached data (normally allowed). -E, --html-extension save all text/html documents with .html extension. --ignore-length ignore `Content-Length' header field. --header=STRING insert STRING among the headers. --proxy-user=USER set USER as proxy username. --proxy-passwd=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. -s, --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --cookies=off don't use cookies. --load-cookies=FILE load cookies from FILE before session. --save-cookies=FILE save cookies to FILE after session. --post-data=STRING use the POST method; send STRING as the data. --post-file=FILE use the POST method; send contents of FILE. FTP options: -nr, --dont-remove-listing don't remove `.listing' files. -g, --glob=on/off turn file name globbing on or off. --passive-ftp use the "passive" transfer mode. --retr-symlinks when recursing, get linked-to files (not dirs). Recursive retrieval: -r, --recursive recursive download. -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). --delete-after delete files locally after downloading them. -k, --convert-links convert non-relative links to relative. -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut option equivalent to -r -N -l inf -nr. -p, --page-requisites get all images, etc. needed to display HTML page. --strict-comments turn on strict (SGML) handling of HTML comments. Recursive accept/reject: -A, --accept=LIST comma-separated list of accepted extensions. -R, --reject=LIST comma-separated list of rejected extensions. -D, --domains=LIST comma-separated list of accepted domains. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. -G, --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. -X, --exclude-directories=LIST list of excluded directories. -np, --no-parent don't ascend to the parent directory. Mail bug reports and suggestions to . waitretrywaituse-proxyrefereruser-agenttriestimeoutsave-cookiesrestrict-file-namesrejectread-timeoutquotaproxy-userproxy-passwdproxyprogresspost-filepost-dataoutput-fileoutput-documentnoload-cookieslimit-ratelevelinput-fileinclude-directoriesignore-tagshttp-userhttp-passwdhtmlifyheaderglobfollow-tagsexclude-domainsexclude-directoriesexecutedot-styledomainsdns-cachedirectory-prefixdns-timeoutcut-dirscookiesconnect-timeoutcachebind-addressbasebackupsappend-outputacceptversionverbosetimestampingstrict-commentsspiderspan-hostsserver-responsesave-headersretry-connrefusedretr-symlinksrelativerecursiverandom-waitquietpage-requisitespassive-ftpnon-verboseno-parentno-http-keep-aliveno-host-lookupno-host-directoriesno-directoriesno-clobbermirrorignore-lengthhtml-extensionhelpforce-htmlforce-hierforce-directoriesfollow-ftpdont-remove-listingdelete-afterdebugconvert-linkscontinuebackup-convertedbackgroundhpVqvdkKsxmNWrHSLcFbEY:G:g:T:U:O:l:n:i:o:a:t:D:A:R:P:B:e:Q:X:I:w:C:onnoparentdeleteafterretrsymlinksignorelengthpassiveftpnoclobberfollowftpcutdirsoffdirstructaddhostdirremovelistingbindaddresshttpkeepaliverandomwaithtmlextensionforcehtmlspanhostsbackupconvertedconvertlinksrelativeonlypagerequisitesserverresponsesaveheadersGNU Wget %s %sCopyright (C) 2003 Free Software Foundation, Inc. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. Originally written by Hrvoje Niksic . retryconnrefusedstrictcommentshttpuserhttppasswddotstyleexcludedomainsproxyuserproxypasswdfollowtagsloadcookiessavecookieslimitratepostdatapostfilednscacherestrictfilenamesdnstimeoutreadtimeoutconnecttimeoutlogfileignoretagsincludedirectoriesinputreclevel%s: illegal option -- `-n%c' Try `%s --help' for more options. outputdocumentdirprefixuseragentexcludedirectoriesuseproxyCan't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. %s: missing URL DEBUG output created by Wget %s on %s. solaris2.7abwbRemoving file due to --delete-after in main(): Removing %s. unlink: %s No URLs found in %s. FINISHED --%s-- Downloaded: %s bytes in %d files Download quota (%s bytes) EXCEEDED! SIGUSR1WTF?!SIGHUP%s/%s.netrcr%s: Cannot read %s (%s). loginpasswordmacdefaccount%s: %s:%d: warning: "%s" token appears before any machine name defaultmachine%s: %s:%d: unknown token "%s" bardot %*s[ skipping %dK ] %5ldK ,%s:%u: failed assertion `%s' progress.cdp->dots < opt.dots_in_line%3d%% %s.@Y @YdefaultbinarymegagigaInvalid dot style specification `%s'; leaving unchanged. percentage <= 100%2d%% 100% dlsz <= progress_sizeinsz <= dlsz %-11sG/sM/sK/sB/s %7.2f%s --.--K/s ETA %02d:%02d ETA %d:%02d:%02d p - bp->buffer <= bp->width@Y@p@ @@ TERMforceemacs@i@bEnqueuing %s at depth %d Queue count %d, maxcount %d. Dequeuing %s at depth %d %s: %s. Already downloaded "%s", reusing it from "%s". Not descending further; at depth %d, max. %d. %s:%u: failed assertion `%s' recur.curl_parsed != NULLRemoving file due to %s in recursive_retrieve(): --delete-afterrecursive rejection criteriaRemoving %s. Removing %s since it should be rejected. unlink: %s Deciding whether to enqueue "%s". Already on the black list. Not following non-HTTP schemes. It doesn't really look like a relative link. The domain was not accepted. Going to "%s" would escape "%s" with no_parent on. %s (%s) is excluded/not-included. %s (%s) does not match acc/rej rules. This is not the same hostname as the parent's (%s and %s). Not following %s because robots.txt forbids it. Decided to load it. Decided NOT to load it. orig_parsed != NULLnew_parsed != NULLRedirection "%s" failed the test. wget%s:%u: failed assertion `%s' res.cj == cnt!EOL (p)Ignoring malformed line %duser-agentallowdisallowIgnoring unknown field at line %dCannot open %s: %s%s path %s because of rule `%s'. AllowingRejecting/robots.txtLoading robots.txt; please ignore errors. deferring a %.2f ms sleep (%ld/%.2f). sleeping %.2f ms for %ld bytes, adjust %.2f ms @@@iAGB/sMB/sKB/sB/s%7.2f %s%.2f %s%s:%u: failed assertion `%s' retr.cmsecs >= 0bytes >= 0%s: %s. Error parsing proxy URL %s: %s. Error in proxy URL %s: Must be HTTP. mynewloc != NULL%d redirections exceeded. Removing file due to --delete-after in retrieve_from_file(): Removing %s. unlink: %s Giving up. Retrying. sleep_between_retrievals: avg=%f,sleep=%f A.A%s.%dhttp_proxyftp_proxy@@@A0?PA>>CBBBBQ00000000000000000000000000000000  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ftp://http://0123456789ABCDEF%s:%u: failed assertion `%s' url.cp2 - newstr == newlen@/?#;ftp://%shttp://%sInvalid IPv6 numeric addressIPv6 addresses not supportedUnterminated IPv6 numeric addressInvalid user nameBad port numberEmpty hostUnsupported schemeNo error:/;?#/;?#;?#?##*p == 0error_code >= 0 && error_code < countof (parse_errors)Removing %s because of directory danger! %s: %sq - TAIL (dest) == outlenindex.html?;#scheme_str != NULL*password*p - result == size%s: %s: Not enough memory. mallocreallocstrdup%02d:%02d:%02d%04d-%02d-%02d %02d:%02d:%02dwget-logforkContinuing in background, pid %d. Output will be written to `%s'. /dev/nullrwutime(%s): %s Unlinking %s (symlink). Failed to unlink symlink `%s': %s rbhtmlhtm1%lld%ld?@@A.Ae%s:%u: failed assertion `%s' utils.csig == SIGALRM@@??A.1.9--(`'l'`00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0,080D0P0\0h0t000000000000000(040@0L0X0d0p0|000000000000 0|0y$0v00s ~ ~)  oCo>o ??l` oo'hph`XPH@xphPH@80( xphAABEACEACTADADAADDAGOAIDAIMAIRALLALPAMAMYANANAANDANNANTANYAPEAPSAPTARCAREARKARMARTASASHASKATATEAUGAUKAVEAWEAWKAWLAWNAXAYEBADBAGBAHBAMBANBARBATBAYBEBEDBEEBEGBENBETBEYBIBBIDBIGBINBITBOBBOGBONBOOBOPBOWBOYBUBBUDBUGBUMBUNBUSBUTBUYBYBYECABCALCAMCANCAPCARCATCAWCODCOGCOLCONCOOCOPCOTCOWCOYCRYCUBCUECUPCURCUTDABDADDAMDANDARDAYDEEDELDENDESDEWDIDDIEDIGDINDIPDODOEDOGDONDOTDOWDRYDUBDUDDUEDUGDUNEAREATEDEELEGGEGOELIELKELMELYEMENDESTETCEVAEVEEWEEYEFADFANFARFATFAYFEDFEEFEWFIBFIGFINFIRFITFLOFLYFOEFOGFORFRYFUMFUNFURGABGADGAGGALGAMGAPGASGAYGEEGELGEMGETGIGGILGINGOGOTGUMGUNGUSGUTGUYGYMGYPHAHADHALHAMHANHAPHASHATHAWHAYHEHEMHENHERHEWHEYHIHIDHIMHIPHISHITHOHOBHOCHOEHOGHOPHOTHOWHUBHUEHUGHUHHUMHUTIICYIDAIFIKEILLINKINNIOIONIQIRAIREIRKISITITSIVYJABJAGJAMJANJARJAWJAYJETJIGJIMJOJOBJOEJOGJOTJOYJUGJUTKAYKEGKENKEYKIDKIMKINKITLALABLACLADLAGLAMLAPLAWLAYLEALEDLEELEGLENLEOLETLEWLIDLIELINLIPLITLOLOBLOGLOPLOSLOTLOULOWLOYLUGLYEMAMACMADMAEMANMAOMAPMATMAWMAYMEMEGMELMENMETMEWMIDMINMITMOBMODMOEMOOMOPMOSMOTMOWMUDMUGMUMMYNABNAGNANNAPNATNAYNENEDNEENETNEWNIBNILNIPNITNONOBNODNONNORNOTNOVNOWNUNUNNUTOOAFOAKOAROATODDODEOFOFFOFTOHOILOKOLDONONEORORBOREORROSOTTOUROUTOVAOWOWEOWLOWNOXPAPADPALPAMPANPAPPARPATPAWPAYPEAPEGPENPEPPERPETPEWPHIPIPIEPINPITPLYPOPODPOEPOPPOTPOWPROPRYPUBPUGPUNPUPPUTQUORAGRAMRANRAPRATRAWRAYREBREDREPRETRIBRIDRIGRIMRIORIPROBRODROERONROTROWROYRUBRUERUGRUMRUNRYESACSADSAGSALSAMSANSAPSATSAWSAYSEASECSEESENSETSEWSHESHYSINSIPSIRSISSITSKISKYSLYSOSOBSODSONSOPSOWSOYSPASPYSUBSUDSUESUMSUNSUPTABTADTAGTANTAPTARTEATEDTEETENTHETHYTICTIETIMTINTIPTOTOETOGTOMTONTOOTOPTOWTOYTRYTUBTUGTUMTUNTWOUNUPUSUSEVANVATVETVIEWADWAGWARWASWAYWEWEBWEDWEEWETWHOWHYWINWITWOKWONWOOWOWWRYWUYAMYAPYAWYEYEAYESYETYOUABEDABELABETABLEABUTACHEACIDACMEACREACTAACTSADAMADDSADENAFARAFROAGEEAHEMAHOYAIDAAIDEAIDSAIRYAJARAKINALANALECALGAALIAALLYALMAALOEALSOALTOALUMALVAAMENAMESAMIDAMMOAMOKAMOSAMRAANDYANEWANNAANNEANTEANTIAQUAARABARCHAREAARGOARIDARMYARTSARTYASIAASKSATOMAUNTAURAAUTOAVERAVIDAVISAVONAVOWAWAYAWRYBABEBABYBACHBACKBADEBAILBAITBAKEBALDBALEBALIBALKBALLBALMBANDBANEBANGBANKBARBBARDBAREBARKBARNBARRBASEBASHBASKBASSBATEBATHBAWDBAWLBEADBEAKBEAMBEANBEARBEATBEAUBECKBEEFBEENBEERBEETBELABELLBELTBENDBENTBERGBERNBERTBESSBESTBETABETHBHOYBIASBIDEBIENBILEBILKBILLBINDBINGBIRDBITEBITSBLABBLATBLEDBLEWBLOBBLOCBLOTBLOWBLUEBLUMBLURBOARBOATBOCABOCKBODEBODYBOGYBOHRBOILBOLDBOLOBOLTBOMBBONABONDBONEBONGBONNBONYBOOKBOOMBOONBOOTBOREBORGBORNBOSEBOSSBOTHBOUTBOWLBOYDBRADBRAEBRAGBRANBRAYBREDBREWBRIGBRIMBROWBUCKBUDDBUFFBULBBULKBULLBUNKBUNTBUOYBURGBURLBURNBURRBURTBURYBUSHBUSSBUSTBUSYBYTECADYCAFECAGECAINCAKECALFCALLCALMCAMECANECANTCARDCARECARLCARRCARTCASECASHCASKCASTCAVECEILCELLCENTCERNCHADCHARCHATCHAWCHEFCHENCHEWCHICCHINCHOUCHOWCHUBCHUGCHUMCITECITYCLADCLAMCLANCLAWCLAYCLODCLOGCLOTCLUBCLUECOALCOATCOCACOCKCOCOCODACODECODYCOEDCOILCOINCOKECOLACOLDCOLTCOMACOMBCOMECOOKCOOLCOONCOOTCORDCORECORKCORNCOSTCOVECOWLCRABCRAGCRAMCRAYCREWCRIBCROWCRUDCUBACUBECUFFCULLCULTCUNYCURBCURDCURECURLCURTCUTSDADEDALEDAMEDANADANEDANGDANKDAREDARKDARNDARTDASHDATADATEDAVEDAVYDAWNDAYSDEADDEAFDEALDEANDEARDEBTDECKDEEDDEEMDEERDEFTDEFYDELLDENTDENYDESKDIALDICEDIEDDIETDIMEDINEDINGDINTDIREDIRTDISCDISHDISKDIVEDOCKDOESDOLEDOLLDOLTDOMEDONEDOOMDOORDORADOSEDOTEDOUGDOURDOVEDOWNDRABDRAGDRAMDRAWDREWDRUBDRUGDRUMDUALDUCKDUCTDUELDUETDUKEDULLDUMBDUNEDUNKDUSKDUSTDUTYEACHEARLEARNEASEEASTEASYEBENECHOEDDYEDENEDGEEDGYEDITEDNAEGANELANELBAELLAELSEEMILEMITEMMAENDSERICEROSEVENEVEREVILEYEDFACEFACTFADEFAILFAINFAIRFAKEFALLFAMEFANGFARMFASTFATEFAWNFEARFEATFEEDFEELFEETFELLFELTFENDFERNFESTFEUDFIEFFIGSFILEFILLFILMFINDFINEFINKFIREFIRMFISHFISKFISTFITSFIVEFLAGFLAKFLAMFLATFLAWFLEAFLEDFLEWFLITFLOCFLOGFLOWFLUBFLUEFOALFOAMFOGYFOILFOLDFOLKFONDFONTFOODFOOLFOOTFORDFOREFORKFORMFORTFOSSFOULFOURFOWLFRAUFRAYFREDFREEFRETFREYFROGFROMFUELFULLFUMEFUNDFUNKFURYFUSEFUSSGAFFGAGEGAILGAINGAITGALAGALEGALLGALTGAMEGANGGARBGARYGASHGATEGAULGAURGAVEGAWKGEARGELDGENEGENTGERMGETSGIBEGIFTGILDGILLGILTGINAGIRDGIRLGISTGIVEGLADGLEEGLENGLIBGLOBGLOMGLOWGLUEGLUMGLUTGOADGOALGOATGOERGOESGOLDGOLFGONEGONGGOODGOOFGOREGORYGOSHGOUTGOWNGRABGRADGRAYGREGGREWGREYGRIDGRIMGRINGRITGROWGRUBGULFGULLGUNKGURUGUSHGUSTGWENGWYNHAAGHAASHACKHAILHAIRHALEHALFHALLHALOHALTHANDHANGHANKHANSHARDHARKHARMHARTHASHHASTHATEHATHHAULHAVEHAWKHAYSHEADHEALHEARHEATHEBEHECKHEEDHEELHEFTHELDHELLHELMHERBHERDHEREHEROHERSHESSHEWNHICKHIDEHIGHHIKEHILLHILTHINDHINTHIREHISSHIVEHOBOHOCKHOFFHOLDHOLEHOLMHOLTHOMEHONEHONKHOODHOOFHOOKHOOTHORNHOSEHOSTHOURHOVEHOWEHOWLHOYTHUCKHUEDHUFFHUGEHUGHHUGOHULKHULLHUNKHUNTHURDHURLHURTHUSHHYDEHYMNIBISICONIDEAIDLEIFFYINCAINCHINTOIONSIOTAIOWAIRISIRMAIRONISLEITCHITEMIVANJACKJADEJAILJAKEJANEJAVAJEANJEFFJERKJESSJESTJIBEJILLJILTJIVEJOANJOBSJOCKJOELJOEYJOHNJOINJOKEJOLTJOVEJUDDJUDEJUDOJUDYJUJUJUKEJULYJUNEJUNKJUNOJURYJUSTJUTEKAHNKALEKANEKANTKARLKATEKEELKEENKENOKENTKERNKERRKEYSKICKKILLKINDKINGKIRKKISSKITEKLANKNEEKNEWKNITKNOBKNOTKNOWKOCHKONGKUDOKURDKURTKYLELACELACKLACYLADYLAIDLAINLAIRLAKELAMBLAMELANDLANELANGLARDLARKLASSLASTLATELAUDLAVALAWNLAWSLAYSLEADLEAFLEAKLEANLEARLEEKLEERLEFTLENDLENSLENTLEONLESKLESSLESTLETSLIARLICELICKLIEDLIENLIESLIEULIFELIFTLIKELILALILTLILYLIMALIMBLIMELINDLINELINKLINTLIONLISALISTLIVELOADLOAFLOAMLOANLOCKLOFTLOGELOISLOLALONELONGLOOKLOONLOOTLORDLORELOSELOSSLOSTLOUDLOVELOWELUCKLUCYLUGELUKELULULUNDLUNGLURALURELURKLUSHLUSTLYLELYNNLYONLYRAMACEMADEMAGIMAIDMAILMAINMAKEMALEMALIMALLMALTMANAMANNMANYMARCMAREMARKMARSMARTMARYMASHMASKMASSMASTMATEMATHMAULMAYOMEADMEALMEANMEATMEEKMEETMELDMELTMEMOMENDMENUMERTMESHMESSMICEMIKEMILDMILEMILKMILLMILTMIMIMINDMINEMINIMINKMINTMIREMISSMISTMITEMITTMOANMOATMOCKMODEMOLDMOLEMOLLMOLTMONAMONKMONTMOODMOONMOORMOOTMOREMORNMORTMOSSMOSTMOTHMOVEMUCHMUCKMUDDMUFFMULEMULLMURKMUSHMUSTMUTEMUTTMYRAMYTHNAGYNAILNAIRNAMENARYNASHNAVENAVYNEALNEARNEATNECKNEEDNEILNELLNEONNERONESSNESTNEWSNEWTNIBSNICENICKNILENINANINENOAHNODENOELNOLLNONENOOKNOONNORMNOSENOTENOUNNOVANUDENULLNUMBOATHOBEYOBOEODINOHIOOILYOINTOKAYOLAFOLDYOLGAOLINOMANOMENOMITONCEONESONLYONTOONUSORALORGYOSLOOTISOTTOOUCHOUSTOUTSOVALOVENOVEROWLYOWNSQUADQUITQUODRACERACKRACYRAFTRAGERAIDRAILRAINRAKERANKRANTRARERASHRATERAVERAYSREADREALREAMREARRECKREEDREEFREEKREELREIDREINRENARENDRENTRESTRICERICHRICKRIDERIFTRILLRIMERINGRINKRISERISKRITEROADROAMROARROBEROCKRODEROILROLLROMEROODROOFROOKROOMROOTROSAROSEROSSROSYROTHROUTROVEROWEROWSRUBERUBYRUDERUDYRUINRULERUNGRUNSRUNTRUSERUSHRUSKRUSSRUSTRUTHSACKSAFESAGESAIDSAILSALESALKSALTSAMESANDSANESANGSANKSARASAULSAVESAYSSCANSCARSCATSCOTSEALSEAMSEARSEATSEEDSEEKSEEMSEENSEESSELFSELLSENDSENTSETSSEWNSHAGSHAMSHAWSHAYSHEDSHIMSHINSHODSHOESHOTSHOWSHUNSHUTSICKSIDESIFTSIGHSIGNSILKSILLSILOSILTSINESINGSINKSIRESITESITSSITUSKATSKEWSKIDSKIMSKINSKITSLABSLAMSLATSLAYSLEDSLEWSLIDSLIMSLITSLOBSLOGSLOTSLOWSLUGSLUMSLURSMOGSMUGSNAGSNOBSNOWSNUBSNUGSOAKSOARSOCKSODASOFASOFTSOILSOLDSOMESONGSOONSOOTSORESORTSOULSOURSOWNSTABSTAGSTANSTARSTAYSTEMSTEWSTIRSTOWSTUBSTUNSUCHSUDSSUITSULKSUMSSUNGSUNKSURESURFSWABSWAGSWAMSWANSWATSWAYSWIMSWUMTACKTACTTAILTAKETALETALKTALLTANKTASKTATETAUTTEALTEAMTEARTECHTEEMTEENTEETTELLTENDTENTTERMTERNTESSTESTTHANTHATTHEETHEMTHENTHEYTHINTHISTHUDTHUGTICKTIDETIDYTIEDTIERTILETILLTILTTIMETINATINETINTTINYTIRETOADTOGOTOILTOLDTOLLTONETONGTONYTOOKTOOLTOOTTORETORNTOTETOURTOUTTOWNTRAGTRAMTRAYTREETREKTRIGTRIMTRIOTRODTROTTROYTRUETUBATUBETUCKTUFTTUNATUNETUNGTURFTURNTUSKTWIGTWINTWITULANUNITURGEUSEDUSERUSESUTAHVAILVAINVALEVARYVASEVASTVEALVEDAVEILVEINVENDVENTVERBVERYVETOVICEVIEWVINEVISEVOIDVOLTVOTEWACKWADEWAGEWAILWAITWAKEWALEWALKWALLWALTWANDWANEWANGWANTWARDWARMWARNWARTWASHWASTWATSWATTWAVEWAVYWAYSWEAKWEALWEANWEARWEEDWEEKWEIRWELDWELLWELTWENTWEREWERTWESTWHAMWHATWHEEWHENWHETWHOAWHOMWICKWIFEWILDWILLWINDWINEWINGWINKWINOWIREWISEWISHWITHWOLFWONTWOODWOOLWORDWOREWORKWORMWORNWOVEWRITWYNNYALEYANGYANKYARDYARNYAWLYAWNYEAHYEARYELLYOGAYOKE?8?(0?((?( I?(?(?(?(J ?( ?( ?( ?( ?(@B0?(?(?(?(?(h`hXHhXX X X h @ X X XXXHHHxphXH8ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/III H8L(HLLLTH$HtLXHLL(LTLLxxh X(LHX@ 0  TTH$4L,L|HXLhxLpx`lLPdH@xH0H `HL0HL,HHLHTLLpLhXH<H8 L(\ PH4H8H$HHL@LXxHp`LPL8(8LLL0HLLL LDLLpLpPhL`XPX0bKckdӸӠxӐxӀFxhhEXPm@0ҰpҨqҘ҈rxLhP@s0S HNvVAaBѰѨCјѐрpXPH@D0(eXgиШGАIЀixlhXPn@O0o YQϸRϠϐψTπtpUhXYPw@܀ltxp<P @P8hXH0'p't'|'''''''''''''''''''''''''((( (((($(0(4(<(@(D(L(Ticmptcpudp-loopbackinetimplinkpupchaosnsnbsecmadatakitccittsnadecnetdlilathylinkappletalknitieee802osix25osinetgosipipx)>?l??E ~ ~ ~  '\'d'l'p(` $FH :G  FF@ Uc'\q(`{'d'lGT G G` (Th  G` +(|8(M(xR\V jpg$ eh [| T ((^ Zl  (._ AGd T]pD nf(@ i  D  n g8 kP@  tpp g8h ,( @Zs$L lL yd(  `( „\ T  P !  T %1 >0 M(W` s$ X(p $  (!    ( (&(3(<(HO ^ gL wd  `  $ ('HT '0 (3 X 5' D2X U. i' zB0 J <4 ; KXX ;p ?( &I 6@D FMOh `( iLx HQ<8 K HK H I0 .I9, Q4| cSd# k uI ~@Rt M H 0 4 I  !H0 ,$ >x` Ld \<h g vh  P `  X  P|  X   $l 4I KL W0P ` uH H  0 P HT x@ @h  P Th h ! 'I$  1I A@  Rpx ]$( s4 I   I VD 4 VH   ` I    # \ :  J  U _h n xθ h@  X8  VL   &(  t( l  &H /| > I Tp _&D l< zVP <p VX VT      $ ,  T !l ;V\L [  k szV`@`&h+,0 < x&X< x( +\ )+\ 8>+\ KH X+\ gOTh r& , My|" TP\| j|( y zT `\ lpL c @ 1 F\ M,H %0 /$8 Dw Pf8 f3x  tyzt z Hl<T ( 4X  \ , 9` My" RY o^ zQx y T| y TL1, ( H#: Lz4 Yy _pfqS $X 0q8 z  0@ kt VT$ y #pP a  N8 "d$ 7<@~ FMS&t, j zT" <q, rH , $ y" ( &4 !˜@ *1Q( A`IO\ S]P lix yMt( y" #0 | r`( 8  P X, $86ɘ ?y" Gz UgTszYL $4 h\  l y T6q ER,h V ( ]R pzT |v `~  $  $o0L y" t t w %d, 9X@F X@bM( oX h t _ l  p\`l x 8 7ut Et O@WD _ph m tZ |   S y   fh yl" w & 7gX D4( PW#x lmD` szz$" *@ '  M c &( z qHH x  t 0 0t G߼@ T|x _hdX lDsKD  w" H  L!O\ PP4 nX w Ut  n< "XH #(P/(Y6 ?DDjlt PΠ _Th q  t z4"  #(H "t (  ;d   d %8 yl %G`X 3 Q d0 tJ }Xhy ΄ j L &08  %\ d8 #O$  2 <o| I P>tH ^R h r, {2  8 4d OD  MT@ v xT 4 ! l| !p !( !1z$ !>t !GFL !Q8 !^!c~H !md !x4!~!jD !!T ! !!k$P ! !θ !&P$ !"~@ "d"l" "()`0 "2(";s4 "DvD "U&$, "l "t"{t ` "r  "Nx "z" "$"""X"O  "  "h ##(#  #'L#/zd #;T #SzD" #^y\" #c" #{Et # #L ##8 ##l ###uL  ##xlT $zD $)y" $1[ $;h@!$@M $Ix$V  $fuXL $}y\ $ $$*\ $@ $|$  $gt $$t $0 $y" $h@$y| %%z %!Ld %*i %8D %E%K%_ %l %H %~ %%%I4 %p8 %%L%G`d %z %|% ` &x &$T &"&)r &1t( wgetcrti.svalues-Xa.ccrtstuff.c__do_global_dtors_auxframe_dummygcc2_compiled.force_to_data__CTOR_LIST__object.11__DTOR_LIST____EH_FRAME_BEGIN__init_dummycompleted.4fini_dummyp.3cmpt.cgcc2_compiled.connect.cbind_address_resolvedconnect_with_timeout_callbackmsockgcc2_compiled.bind_addressconnection_host_nameaddrconvert.cconvert_linksv4.67df_free_mapperfind_fragmentwrite_backup_filegcc2_compiled.v3.66downloaded_files_hashv2.65downloaded_html_listlocal_quote_stringconstruct_relativedl_file_url_mapconverted_files.24match_except_indexv1.64replace_attrreplace_attr_refresh_hackdissociate_urls_from_file_mappercookies.cdiscard_matching_cookieequality_comparatornuke_cookie_chainparse_set_cookiesgcc2_compiled.update_cookie_fieldcheck_domain_matchstore_cookiesave_cookies_mapperknown_toplevel_domains.36numeric_address_ppath_matchesgoodness_comparatorftp.cftp_loop_internaldepth.27ftp_retrieve_dirsdelelementgcc2_compiled.ftp_retrieve_globfreefileinfogetftpftp_retrieve_listftp_expected_bytesftp-basic.cskey_head.21gcc2_compiled.numbuf.37ftp-ls.cftp_parse_winnt_lsgcc2_compiled.months.31months.38months.21ftp_parse_vms_lsftp_parse_unix_lsftp-opie.cbuf.15gcc2_compiled.Wpbtoegetopt.cgcc2_compiled.posixly_correctexchangenextcharfirst_nonoptorderinglast_nonopthash.cgcc2_compiled.primes.9grow_hash_tablestring_cmp_nocasestring_hash_nocaseheaders.cgcc2_compiled.host.cgcc2_compiled.host_name_addresses_maphost_cleanup_mappergethostbyname_with_timeout_callbackhtml-parse.cname_allowedgcc2_compiled.find_comment_endadvance_declarationconvert_and_copyhtml-url.ctag_handle_metatag_handle_formtag_url_attributesappend_urlgcc2_compiled.known_tagscollect_tags_mapperadditional_attributesinit_interestingtag_find_urlstag_handle_basetag_handle_linkhttp.chttp_process_rangechunk.18basic_authentication_encodepc_last_host_ipregister_persistentgcc2_compiled.pc_last_portparse_http_status_linepc_active_poptions.81extract_header_attropaque.79digest_authentication_encodepc_last_fdhttp_process_connectionhttp_process_typegethttpcheck_endnonce.80time_formats.61tbl.65persistent_available_ppost_filecookies_loaded_pknown_authentication_scheme_pcreate_authorization_linehttp_process_nonerealm.78init.ccmd_stringcmd_spec_progresscmd_directorysetval_internalrun_wgetrccmd_number_infcmd_spec_headercmd_spec_restrict_file_namescmd_spec_recursivegcc2_compiled.cmd_timedefaultscmd_spec_useragentcmd_spec_dirstructcheck_user_specified_headerparse_linecmd_spec_mirrorenable_tilde_expansioncmd_booleancommandscmd_directory_vectorcmd_vectorcmd_spec_timeoutsimple_atofsimple_atoicmd_lockable_booleancmd_filecmd_spec_htmlifycmd_bytes_largeparse_bytes_helperwgetrc_file_namecmd_numbercmd_byteslog.clog_linesinhibit_logginglog_dump_contextlogvprintfcheck_redirect_outputgcc2_compiled.save_context_pflush_log_plogfptrailing_linesaved_append_1redirect_request_signal_namelog_line_currentredirect_outputneeds_flushingmain.cgcc2_compiled.redirect_output_signallong_options.27print_helpgen-md5.cgcc2_compiled.gnu-md5.cgcc2_compiled.fillbufnetrc.cparse_netrcgcc2_compiled.processed_netrc.9progress.ccreate_imageimplementationsbar_createdot_set_paramsdot_finishgcc2_compiled.short_units.66bar_set_paramsdot_updatedot_createbar_updatescreen_widthdisplay_imagecurrent_implbar_finishoutput_redirectedcurrent_impl_lockedupdate_speed_ringrbuf.cgcc2_compiled.recur.cdescend_redirect_pgcc2_compiled.download_child_pres.ccleanup_hash_table_mapperregistered_specsgcc2_compiled.prune_non_exactmatchesretr.cdlbuf.21res.25first_retrieval.42no_proxy_matchgcc2_compiled.limit_datarate_names.26limit_bandwidthrewritten_storage.52getproxysafe-ctype.cgcc2_compiled.snprintf.cgcc2_compiled.url.curl_unescapeurlchr_tablegcc2_compiled.split_pathparse_errorsappend_uri_pathelurl_escape_1filechr_tablereencode_escapessupported_schemessync_pathpath_simplifyutils.cseeded.210free_keys_and_values_mappergcc2_compiled.outbuf.161run_with_timeout_envabort_run_with_timeoutstring_set_free_mapperoutput.52output.48unique_name_1in_acclistversion.cgcc2_compiled.socket.cweaks.c_soutil.cproto_swfamily_sw_s_match_netconflibgcc2.cLetextcrtstuff.c__DTOR_END____do_global_ctors_aux__CTOR_END__gcc2_compiled.force_to_datainit_dummy__FRAME_END__crtn.s_START__END_random_floatmap_ipv4_to_ipregister_htmlglobal_download_countwtimer_allocateclosenumber_to_stringfile_non_directory_pgetopt_long_onlyconaddrh_errnogmtimematch_tailhash_table_putacceptgettextlog_set_flushcookie_jar_newinitialize_s_netconfig_path_so_shutdownutimerun_commandfflushfile_sizeregister_redirectionftp_get_listingurl_has_schemeget_urls_htmlurl_erroroptsleep_between_retrievalspretty_print_address_socket_bsddownloaded_files_freemap_html_tagsfreeinet_addr__xnet_listen__xnet_recvmsggetnetconfigsymlink_so_recvstring_hashinet_ntoagethostbynamecleanupsnprintfsetsidftp_process_typegetpwuid__deregister_frame_infoftp_parse_lshash_table_get_pairsendselect__register_frame_infomerge_vecsmallocset_connection_host_namememchrgettimeofday_recvmsgstrcatfile_mergeabort_connectcookies_now.uremstrstraccessrewrite_shorthand_urlretr_rate_so_accepttotal_downloaded_bytesres_retrieve_file_getsockname_sendsscanf_so_sendtomake_directorylogflushlstatslist_free__xnet_connecthash_table_getlogputssrandremove_linkaccdir_sendmsgaddress_list_set_faultydownloaded_fileopterrireadsiglongjmpregister_delete_filereadlink_finirenamewritewget_sockaddr_get_portlog_set_save_contextsetsockopt_so_getsockname_so_listen_so_recvmsgslist_nreversestring_set_containsretrieve_treesleepsufmatchrecvmsgftp_systmap_ip_to_ipv4dl_url_file_mapftp_pasvusleepconnect_to_manyfnmatchsepstringvsnprintfres_match_pathdatetime_strisattyurl_set_dirmemcmpshutdownretrieve_from_fileqsortcookie_jar_savestring_set_free_PROCEDURE_LINKAGE_TABLE_readtextdomain_sch_tolowerftp_cwdprogress_updateftp_last_resplineftp_portsendmsg__xnet_sendtoip_default_family_so_connectmemsetmmapnetrc_listreallocfreadhas_html_suffix_pendnetconfiglookup_hosttime_stroptindheader_strdup_GLOBAL_OFFSET_TABLE_atexitchmodrbuf_peekstrchr_shutdowninteresting_attributesstring_set_addtest_socket_opengetoptfork_to_background_setsockopthttp_loop__getopt_initialized_lib_versionstrpbrk_etextfgetchash_table_clearfilenorbuf_discardfprintfexitstatfree_vecrecvstrerrorget_contents_socket_svr4memcpysearch_netrcstrdupftellmd5_process_byteslocaltimeurl_set_fileprogress_createres_parse_from_filewtimer_elapsedlegible_large_intperrorbindtextdomainfile_exists_pfgets___errnoregister_downloadvalid_progress_implementation_prandprogress_handle_sigwinchrandom_numbersetoptvalfreopenptrhashslist_prependset_progress_implementationvfprintfread_whole_linedebug_logprintf_so_setsockoptfstathash_table_containscloseport_recv_statsetitimer_exitconvert_cleanuplisten__xnet_socketredirect_requestxmalloc_realgetopt_longgetenvaddress_list_releasesuffixunlinkgetpeernameprintwhat_endrotate_backupsurl_escapestrlenhtml_quote_stringsockaddr_len__xnet_sendmsgslist_containsstrtokhash_table_mapstrtolwtimer_deletecookie_jar_deletemake_string_hash_tablemd5_init_ctxrbuf_flushxstrdup_realstrcmpcleanup_html_urlftp_retrsocketprogress_schedule_redirectlog_closemunmapenvironiwriteinteresting_tagsftp_loophas_wildcards_p_socketacceptableread_file_freeherrmsg.remgetuid_edataftp_rest.divstrdupdelimgen_md5_finishmd5_process_blockhash_table_newftp_listgetsocknameheader_extract_numberaddress_list_match_alladdress_list_copy_onehttp_cleanuphash_table_destroy_so_sendmkalldirsmainhost_cleanup_listenget_urls_filemake_nocase_string_hash_tableres_register_specsprogress_finishbindportexec_name__dtoll_recvfromgen_md5_updatecount_charversion_string_so_bindstrcpy_sch_toupperheader_existswget_sockaddr_set_addresslog_request_redirect_outputscheme_disablelogprintfslist_appendfcloseurl_file_nameselect_fdftp_indexstrptimeurl_parseheader_geturl_full_pathftp_loginschemes_are_similar_pfputcacceptportcookie_jar_process_set_cookie_socket_createhash_table_countres_get_specsgen_md5_initftp_size_getpeernameftp_typeuri_merge_sch_istabletime__eprintfhttp_atotmfputssetnetconfigfrontcmpsignalconvert_all_linksftruncateioctltouchheader_processmd5_finish_ctxwget_sockaddr_get_addrsigsetjmpcookie_jar_loadmkdirstrncpysprintfcalc_rate__flsbufnumdigitrun_with_timeoutwget_sockaddr_set_portstrrchrmktimewtimer_newfree_keys_and_valuesurl_schemesendto_so_socketsetlocale_so_getpeernamestrncasecmpscheme_default_portres_parsegen_md5_context_size.umulforkstring_cmpasctime__xnet_bindhttp_process_set_cookiegetsockoptbindaddress_list_get_bounds_startrbuf_read_bufferfullog_initfseekres_cleanupoptargunique_name_so_sendmsgwget_cookie_jarwtimer_granularitystrncmpcookie_jar_generate_cookie_header_getsockoptconnectread_file_ioburl_free_so_recvfromrbuf_initializedetermine_screen_width_bindptrcmprewindfree_urlposftp_pwdopenrbuf_uninitializexrealloc_realfwritefree_netrcftp_responserecvfrom__iob_accept_so_getsockopt__xnet_getsockopthome_dirxstrdup_lowerretrieve_urlfopendownloaded_html_setmd5_read_ctxrbuf_initialized_pskip_lws_init_DYNAMICatoiurl_stringcalculate_skey_responseoptopt_environconnect_to_one_sendtostrcasecmp_getopt_internalhash_table_removeaccept_domainprintflegiblewtimer_resetas: WorkShop Compilers 5.0 Alpha 03/27/98 Build as: WorkShop Compilers 5.0 Alpha 03/27/98 Build @(#)SunOS 5.7 Generic October 1998as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)@(#)SunOS 5.7 Generic October 1998@(#)SunOS 5.7 Generic October 1998@(#)SunOS 5.7 Generic October 1998as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.3 20010315 (TWW)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build ld: Software Generation Utilities - Solaris-ELF (4.0)q <I4p <F4m <E4s <G4$ d~-d~A<P̀Bڀ*Puˀ'Kuɂ 0NmـmpÂق O%+ŀ3ڀ<Q   3 P ! ߀# ' )> >D TE jJ N O P ŀU ܀^ _ n &o ?w [} x~ Ѐ *5 C6 ^L wM S T U ԀV X Y Z 5] Me fl |m n p €q ـr st4Iawŀ݀2Klр}߀)D#\$t*789р:;<=2CGG^StZ[i2؀q}=u׀<`ɀ 3IavӀ/E]uڀ &>|‚ۀ 8Le+H'<R[6P-f/}N҂ ̀!_!t!!X!Y!ƀZ!܀[!\"^"_"3e"Ih"a""Ђ"###3#S#m$+)$?<$ZY$oa$$~$@$@$@$@$$H$d~X.interp.hash.dynsym.dynstr.SUNW_version.rela.got.rela.bss.rela.plt.text.init.fini.rodata.rodata1.got.plt.dynamic.data.ctors.dtors.eh_frame.data1.bss.symtab.strtab.comment.stab.index.stab.shstrtab.stab.indexstr.stabstrvalues-Xa.cXt ; O ; V=3.1 ; R=WorkShop Compilers 4.2 30 Oct 1996 C 4.2/builds3/s998_21a/usr/src/lib/libc/sparc; /opt/SUNWspro.40/SC4.2/bin/../SC4.2/bin/cc -xO3 -xcg89 -Wa,-cg92 -xspace -W0,-Lt -Xt -D_REENTRANT -Dsparc -Iinc -I../inc -DTEXT_DOMAIN='"SUNW_OST_OSLIB"' -I/builds3/s998_21a/proto/root_sparc/usr/include -c -o values-Xa.o ../port/gen/values-Xa.c -W0,-xpsocket.cXt ; O ; V=3.1 ; R=WorkShop Compilers 4.2 30 Oct 1996 C 4.2/builds3/s998_21a/usr/src/lib/libsocket/sparc; /opt/SUNWspro.40/SC4.2/bin/../SC4.2/bin/cc -xO3 -xcg89 -Wa,-cg92 -xregs=no%%appl -xspace -W0,-Lt -Xt -DTEXT_DOMAIN='"SUNW_OST_OSLIB"' -I/builds3/s998_21a/proto/root_sparc/usr/include -DSYSV -D_REENTRANT -c -o objs/socket.o ../socket/socket.c -W0,-xpweaks.cXt ; O ; V=3.1 ; R=WorkShop Compilers 4.2 30 Oct 1996 C 4.2/builds3/s998_21a/usr/src/lib/libsocket/sparc; /opt/SUNWspro.40/SC4.2/bin/../SC4.2/bin/cc -xO3 -xcg89 -Wa,-cg92 -xregs=no%%appl -xspace -W0,-Lt -Xt -DTEXT_DOMAIN='"SUNW_OST_OSLIB"' -I/builds3/s998_21a/proto/root_sparc/usr/include -DSYSV -D_REENTRANT -c -o objs/weaks.o ../socket/weaks.c -W0,-xp_soutil.cXt ; O ; V=3.1 ; R=WorkShop Compilers 4.2 30 Oct 1996 C 4.2/builds3/s998_21a/usr/src/lib/libsocket/sparc; /opt/SUNWspro.40/SC4.2/bin/../SC4.2/bin/cc -xO3 -xcg89 -Wa,-cg92 -xregs=no%%appl -xspace -W0,-Lt -Xt -DTEXT_DOMAIN='"SUNW_OST_OSLIB"' -I/builds3/s998_21a/proto/root_sparc/usr/include -DSYSV -D_REENTRANT -c -o objs/_soutil.o ../socket/_soutil.c -W0,-xplibgcc2.c/opt/build/gcc-2.95.3/objdir/gcc/../../gcc/libgcc2.cgcc2_compiled.int:t(0,1)=r(0,1);0020000000000;0017777777777;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,1);0020000000000;0017777777777;unsigned int:t(0,4)=r(0,1);0000000000000;0037777777777;long unsigned int:t(0,5)=r(0,1);0000000000000;0037777777777;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.h../../gcc/gansidecl.h../../gcc/../include/ansidecl.h../../gcc/config/xm-siglist.h../../gcc/config/sparc/xm-sysv4.htm.h../../gcc/config/sparc/sol2-sld.h../../gcc/config/sparc/sol2.h../../gcc/config/sparc/sysv4.h../../gcc/config/sparc/sparc.hcmodel:T(10,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(10,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_HYPERSPARC:7,PROCESSOR_SPARCLITE86X:8,PROCESSOR_SPARCLET:9,PROCESSOR_TSC701:10,PROCESSOR_V9:11,PROCESSOR_ULTRASPARC:12,;sparc_cpu_select:T(10,3)=s16string:(10,4)=*(0,2),0,32;name:(10,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(10,5)=eNO_REGS:0,FPCC_REGS:1,I64_REGS:2,GENERAL_REGS:3,FP_REGS:4,EXTRA_FP_REGS:5,GENERAL_OR_FP_REGS:6,GENERAL_OR_EXTRA_FP_REGS:7,ALL_REGS:8,LIM_REG_CLASSES:9,;sparc_args:T(10,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;../../gcc/config/svr4.h../../gcc/config/dbxelf.h../../gcc/config/sparc/xm-sol2.h/usr/include/stdlib.h/usr/include/sys/feature_tests.h/usr/include/sys/isa_defs.hdiv_t:t(14,1)=(14,2)=s8quot:(0,1),0,32;rem:(0,1),32,32;;ldiv_t:t(14,3)=(14,4)=s8quot:(0,3),0,32;rem:(0,3),32,32;;lldiv_t:t(14,5)=(14,6)=s16quot:(0,6),0,64;rem:(0,6),64,64;;size_t:t(14,7)=(0,4)uid_t:t(14,8)=(0,3)wchar_t:t(14,9)=(0,3)/usr/include/unistd.h/usr/include/sys/types.h/usr/include/sys/machtypes.h_physadr_t:T(19,1)=s4r:(19,2)=ar(0,1);0;0;(0,1),0,32;;physadr_t:t(19,3)=(19,4)=*(19,1)_label_t:T(19,5)=s8val:(19,6)=ar(0,1);0;1;(0,3),0,64;;label_t:t(19,7)=(19,5)lock_t:t(19,8)=(0,11)/usr/include/sys/int_types.hint8_t:t(20,1)=(0,2)int16_t:t(20,2)=(0,8)int32_t:t(20,3)=(0,1)int64_t:t(20,4)=(0,6)uint8_t:t(20,5)=(0,11)uint16_t:t(20,6)=(0,9)uint32_t:t(20,7)=(0,4)uint64_t:t(20,8)=(0,7)intmax_t:t(20,9)=(20,4)uintmax_t:t(20,10)=(20,8)intptr_t:t(20,11)=(0,1)uintptr_t:t(20,12)=(0,4)int_least8_t:t(20,13)=(0,2)int_least16_t:t(20,14)=(0,8)int_least32_t:t(20,15)=(0,1)int_least64_t:t(20,16)=(0,6)uint_least8_t:t(20,17)=(0,11)uint_least16_t:t(20,18)=(0,9)uint_least32_t:t(20,19)=(0,4)uint_least64_t:t(20,20)=(0,7)longlong_t:t(18,1)=(0,6)u_longlong_t:t(18,2)=(0,7)t_scalar_t:t(18,3)=(0,3)t_uscalar_t:t(18,4)=(0,5)uchar_t:t(18,5)=(0,11)ushort_t:t(18,6)=(0,9)uint_t:t(18,7)=(0,4)ulong_t:t(18,8)=(0,5)caddr_t:t(18,9)=(18,10)=*(0,2)daddr_t:t(18,11)=(0,3)cnt_t:t(18,12)=(0,8)paddr_t:t(18,13)=(18,8)ptrdiff_t:t(18,14)=(0,1)pfn_t:t(18,15)=(18,8)pgcnt_t:t(18,16)=(18,8)spgcnt_t:t(18,17)=(0,3)use_t:t(18,18)=(18,5)sysid_t:t(18,19)=(0,8)index_t:t(18,20)=(0,8)timeout_id_t:t(18,21)=(18,22)=*(0,19)bufcall_id_t:t(18,23)=(18,22)off_t:t(18,24)=(0,3)off64_t:t(18,25)=(18,1)ino_t:t(18,26)=(18,8)blkcnt_t:t(18,27)=(0,3)fsblkcnt_t:t(18,28)=(18,8)fsfilcnt_t:t(18,29)=(18,8)ino64_t:t(18,30)=(18,2)blkcnt64_t:t(18,31)=(18,1)fsblkcnt64_t:t(18,32)=(18,2)fsfilcnt64_t:t(18,33)=(18,2)blksize_t:t(18,34)=(0,3) :T(18,35)=eB_FALSE:0,B_TRUE:1,;boolean_t:t(18,36)=(18,35)pad64_t:t(18,37)=(20,4)upad64_t:t(18,38)=(20,8)offset_t:t(18,39)=(18,1)u_offset_t:t(18,40)=(18,2)len_t:t(18,41)=(18,2)diskaddr_t:t(18,42)=(18,1)lloff_t:t(18,43)=(18,44)=u8_f:(18,39),0,64;_p:(18,45)=s8_u:(20,3),0,32;_l:(20,3),32,32;;,0,64;;lldaddr_t:t(18,46)=(18,47)=u8_f:(18,42),0,64;_p:(18,48)=s8_u:(20,3),0,32;_l:(20,3),32,32;;,0,64;;k_fltset_t:t(18,49)=(18,7)id_t:t(18,50)=(0,3)useconds_t:t(18,51)=(18,7)suseconds_t:t(18,52)=(0,3)major_t:t(18,53)=(18,8)minor_t:t(18,54)=(18,8)pri_t:t(18,55)=(0,8)o_mode_t:t(18,56)=(18,6)o_dev_t:t(18,57)=(0,8)o_uid_t:t(18,58)=(18,6)o_gid_t:t(18,59)=(18,58)o_nlink_t:t(18,60)=(0,8)o_pid_t:t(18,61)=(0,8)o_ino_t:t(18,62)=(18,6)key_t:t(18,63)=(0,1)mode_t:t(18,64)=(18,8)gid_t:t(18,65)=(14,8)pthread_t:t(18,66)=(0,4)pthread_key_t:t(18,67)=(0,4)_pthread_mutex:T(18,68)=s24__pthread_mutex_flags:(18,69)=s8__pthread_mutex_flag:(18,70)=ar(0,1);0;3;(20,5),0,32;__pthread_mutex_type:(20,7),32,32;;,0,64;__pthread_mutex_lock:(18,71)=u8__pthread_mutex_lock64:(18,72)=s8__pthread_mutex_pad:(18,73)=ar(0,1);0;7;(20,5),0,64;;,0,64;__pthread_mutex_owner64:(18,38),0,64;;,64,64;__pthread_mutex_data:(18,38),128,64;;pthread_mutex_t:t(18,74)=(18,68)_pthread_cond:T(18,75)=s16__pthread_cond_flags:(18,76)=s8__pthread_cond_flag:(18,70),0,32;__pthread_cond_type:(20,7),32,32;;,0,64;__pthread_cond_data:(18,38),64,64;;pthread_cond_t:t(18,77)=(18,75)_pthread_rwlock:T(18,78)=s64__pthread_rwlock_readers:(20,3),0,32;__pthread_rwlock_type:(20,6),32,16;__pthread_rwlock_magic:(20,6),48,16;__pthread_rwlock_pad1:(18,79)=ar(0,1);0;2;(18,38),64,192;__pthread_rwlock_pad2:(18,80)=ar(0,1);0;1;(18,38),256,128;__pthread_rwlock_pad3:(18,80),384,128;;pthread_rwlock_t:t(18,81)=(18,78)_pthread_attr:T(18,82)=s4__pthread_attrp:(18,22),0,32;;pthread_attr_t:t(18,83)=(18,82)_pthread_mutexattr:T(18,84)=s4__pthread_mutexattrp:(18,22),0,32;;pthread_mutexattr_t:t(18,85)=(18,84)_pthread_condattr:T(18,86)=s4__pthread_condattrp:(18,22),0,32;;pthread_condattr_t:t(18,87)=(18,86)_once:T(18,88)=s32__pthread_once_pad:(18,89)=ar(0,1);0;3;(18,38),0,256;;pthread_once_t:t(18,90)=(18,88)_pthread_rwlockattr:T(18,91)=s4__pthread_rwlockattrp:(18,22),0,32;;pthread_rwlockattr_t:t(18,92)=(18,91)dev_t:t(18,93)=(18,8)nlink_t:t(18,94)=(18,8)pid_t:t(18,95)=(0,3)ssize_t:t(18,96)=(0,1)time_t:t(18,97)=(0,3)clock_t:t(18,98)=(0,3)clockid_t:t(18,99)=(0,1)timer_t:t(18,100)=(0,1)unchar:t(18,101)=(0,11)ushort:t(18,102)=(0,9)uint:t(18,103)=(0,4)ulong:t(18,104)=(0,5)u_char:t(18,105)=(0,11)u_short:t(18,106)=(0,9)u_int:t(18,107)=(0,4)u_long:t(18,108)=(0,5)_quad:T(18,109)=s8val:(18,110)=ar(0,1);0;1;(0,1),0,64;;quad_t:t(18,111)=(18,109)quad:t(18,112)=(18,111)/usr/include/sys/select.h/usr/include/sys/time.htimeval:T(22,1)=s8tv_sec:(18,97),0,32;tv_usec:(18,52),32,32;;timezone:T(22,2)=s8tz_minuteswest:(0,1),0,32;tz_dsttime:(0,1),32,32;;/usr/include/sys/types.hitimerval:T(22,3)=s16it_interval:(22,1),0,64;it_value:(22,1),64,64;;hrtime_t:t(22,4)=(18,1)/usr/include/time.h/usr/include/sys/types.htm:T(24,1)=s36tm_sec:(0,1),0,32;tm_min:(0,1),32,32;tm_hour:(0,1),64,32;tm_mday:(0,1),96,32;tm_mon:(0,1),128,32;tm_year:(0,1),160,32;tm_wday:(0,1),192,32;tm_yday:(0,1),224,32;tm_isdst:(0,1),256,32;;/usr/include/sys/time_impl.htimespec:T(26,1)=s8tv_sec:(18,97),0,32;tv_nsec:(0,3),32,32;;timespec_t:t(26,2)=(26,1)timestruc_t:t(26,3)=(26,1)itimerspec:T(26,4)=s16it_interval:(26,1),0,64;it_value:(26,1),64,64;;itimerspec_t:t(26,5)=(26,4)sigval:T(24,2)=u4sival_int:(0,1),0,32;sival_ptr:(18,22),0,32;;sigevent:T(24,3)=s24sigev_notify:(0,1),0,32;sigev_signo:(0,1),32,32;sigev_value:(24,2),64,32;sigev_notify_function:(24,4)=*(24,5)=f(0,19),96,32;sigev_notify_attributes:(24,6)=*(18,83),128,32;__sigev_pad2:(0,1),160,32;;/usr/include/sys/select.hfd_mask:t(21,1)=(0,3)fds_mask:t(21,2)=(0,3)fd_set:T(21,3)=s128fds_bits:(21,4)=ar(0,1);0;31;(0,3),0,1024;;fd_set:t(21,5)=(21,3)/usr/include/sys/unistd.h../../gcc/machmode.h../../gcc/machmode.defmachine_mode:T(29,1)=eVOIDmode:0,PQImode:1,QImode:2,PHImode:3,HImode:4,PSImode:5,SImode:6,PDImode:7,DImode:8,TImode:9,OImode:10,QFmode:11,HFmode:12,TQFmode:13,SFmode:14,DFmode:15,XFmode:16,TFmode:17,QCmode:18,HCmode:19,SCmode:20,DCmode:21,XCmode:22,TCmode:23,CQImode:24,CHImode:25,CSImode:26,CDImode:27,CTImode:28,COImode:29,BLKmode:30,CCmode:31,CCXmode:32,CC_NOOVmode:33,CCX_NOOVmode:34,CCFPmode:35,CCFPEmode:36,\MAX_MACHINE_MODE:37,;mode_class:T(29,2)=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;../../gcc/defaults.hinclude/stddef.hwint_t:t(32,1)=(0,4)UQItype:t(0,20)=(0,11)SItype:t(0,21)=(0,1)USItype:t(0,22)=(0,4)DItype:t(0,23)=(0,6)UDItype:t(0,24)=(0,7)SFtype:t(0,25)=(0,12)DFtype:t(0,26)=(0,13)TFtype:t(0,27)=(0,14)word_type:t(0,28)=(0,1)DIstruct:T(0,29)=s8high:(0,21),0,32;low:(0,21),32,32;;DIunion:t(0,30)=(0,31)=u8s:(0,29),0,64;ll:(0,23),0,64;;/usr/include/stdio.h/usr/include/sys/va_list.h__va_list:t(34,1)=(18,22)/usr/include/stdio_tag.h__FILE:t(35,1)=(35,2)=xs__FILE:/usr/include/stdio_impl.h__FILE:T(35,2)=s16_cnt:(18,96),0,32;_ptr:(36,1)=*(0,11),32,32;_base:(36,1),64,32;_flag:(0,11),96,8;_file:(0,11),104,8;__orientation:(0,4),112,2;__ionolock:(0,4),114,1;__filler:(0,4),115,5;;FILE:t(33,1)=(35,1)__longlong_t:t(33,2)=(0,6)fpos_t:t(33,3)=(0,3)fpos64_t:t(33,4)=(33,2)__eprintf:F(0,19)string:P(10,4)expression:P(10,4)line:P(0,4)filename:P(10,4)   @"))o>>p-B?l?l$ 7B??0 AB??  KEE8Q~~W~~]~~ren$s@ x.|'\'\'d'd'l'l'p'p(`(`vh(\0X Y &>J b <   $