@P  @  @@@.text@ @ g@ .data@@]@.xdata]@]@&@.pdata  ! .rdata  |.rconstp p p .lita@@KC.lit8@@.sdata@@.sbss@@.bss@@.comment= @(#)$RCSfile: crt0.s,v $ $Revision: 1.1.24.3 $ (DEC) $Date: 1995/03/14 16:57:40 $@(#)$RCSfile: exit.c,v $ $Revision: 4.2.11.4 $ (DEC) $Date: 1994/04/05 22:09:46 $@(#)$RCSfile: strerror.c,v $ $Revision: 4.2.8.3 $ (DEC) $Date: 1994/04/05 15:48:37 $libc.catError %d occurred.@(#)$RCSfile: abort.c,v $ $Revision: 4.2.9.4 $ (DEC) $Date: 1994/05/27 20:40:44 $@(#)$RCSfile: fopen.c,v $ $Revision: 4.2.9.3 $ (DEC) $Date: 1994/06/13 21:05:12 $@(#)$RCSfile: fwrite.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/04 21:29:14 $@(#)$RCSfile: malloc.c,v $ $Revision: 4.2.24.3 $ (DEC) $Date: 1995/06/07 21:31:28 $@(#)$RCSfile: flsbuf.c,v $ $Revision: 4.2.11.2 $ (DEC) $Date: 1994/04/04 21:28:04 $@(#)$RCSfile: fputs.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/04 21:28:23 $@(#)$RCSfile: sprintf.c,v $ $Revision: 4.2.11.2 $ (DEC) $Date: 1994/10/14 17:11:35 $%*.*f%*.*f%*.*f%*.*f%*.*%*.%*%f*f.*f*.*f@(#)$RCSfile: ctime.c,v $ $Revision: 4.4.25.2 $ (DEC) $Date: 1995/04/21 20:15:03 $GMT@(#)$RCSfile: strcasecmp.c,v $ $Revision: 4.2.9.2 $ (DEC) $Date: 1994/04/05 15:48:02 $@(#)$RCSfile: scanf.c,v $ $Revision: 4.2.10.2 $ (DEC) $Date: 1994/04/05 15:45:13 $@(#)$RCSfile: time.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/05 16:12:12 $@(#)$RCSfile: strncmp.c,v $ $Revision: 4.2.11.4 $ (DEC) $Date: 1994/04/20 16:56:44 $@(#)$RCSfile: qsort.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/05 15:27:48 $@(#)$RCSfile: fputc.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/04 21:28:17 $@(#)$RCSfile: fprintf.c,v $ $Revision: 4.2.9.2 $ (DEC) $Date: 1994/04/04 21:28:13 $@(#)$RCSfile: rew.c,v $ $Revision: 4.2.9.2 $ (DEC) $Date: 1994/04/05 15:29:30 $@(#)$RCSfile: strstr.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/05 15:49:20 $@(#)$RCSfile: strncpy.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/05 15:48:58 $@(#)$RCSfile: strtok.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/05 15:49:33 $@(#)$RCSfile: strtol.c,v $ $Revision: 4.3.13.2 $ (DEC) $Date: 1994/08/03 14:33:56 $@(#)$RCSfile: atoi.c,v $ $Revision: 4.2.10.2 $ (DEC) $Date: 1994/11/07 19:18:55 $@(#)$RCSfile: fgetc.c,v $ $Revision: 4.2.10.3 $ (DEC) $Date: 1994/04/05 22:10:00 $@(#)$RCSfile: getenv.c,v $ $Revision: 4.2.9.2 $ (DEC) $Date: 1994/04/04 21:29:45 $@(#)$RCSfile: gethostent.c,v $ $Revision: 4.2.16.3 $ (DEC) $Date: 1994/09/28 17:00:57 $ # r%d.%d.%d.%d.in-addr.arpahosts.byaddrhosts.bynamehosts-%d%.*s.%.*s@(#)$RCSfile: herror.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/04 21:43:13 $Error 0Unknown hostHost name lookup failureUnknown server errorNo address associated with name : libc.catUnknown error,\@(#)$RCSfile: inet_ntoa.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/04 21:43:31 $%d.%d.%d.%d@(#)$RCSfile: inet_addr.c,v $ $Revision: 4.2.9.2 $ (DEC) $Date: 1994/04/04 21:43:23 $@(#)$RCSfile: fread.c,v $ $Revision: 4.3.10.2 $ (DEC) $Date: 1994/04/04 21:28:38 $@(#)$RCSfile: strptime.c,v $ $Revision: 1.1.14.2 $ (DEC) $Date: 1995/05/31 15:07:20 $%1[-+]:%u:%d/%d/%d:%63[^:]:%63[^:]:%n 0Lalnum%H:%M:%S%p%[+-]:%u:%99[^:]:%99[^:]:%99[^:]:%n%m/%d/%y%H:%M%I:%M:%S ;4d8D 0``dlp(t(((((((((((((((((((((((((((((((((((((((((@(#)$RCSfile: getpasswd.c,v $ $Revision: 1.1.11.2 $ (DEC) $Date: 1994/04/04 21:30:55 $@(#)$RCSfile: vfprintf.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/05 16:15:00 $@(#)$RCSfile: perror.c,v $ $Revision: 4.2.9.2 $ (DEC) $Date: 1994/04/05 15:25:26 $ : libc.catError %d occurred.@(#)$RCSfile: isatty.c,v $ $Revision: 4.2.9.2 $ (DEC) $Date: 1994/04/04 21:44:10 $@(#)$RCSfile: printf.c,v $ $Revision: 4.2.9.2 $ (DEC) $Date: 1994/04/05 15:26:18 $@(#)$RCSfile: signal.c,v $ $Revision: 4.3.7.2 $ (DEC) $Date: 1994/04/05 15:47:06 $@(#)$RCSfile: usleep.c,v $ $Revision: 4.2.7.3 $ (DEC) $Date: 1994/04/05 16:14:42 $@(#)$RCSfile: sleep.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/05 15:47:34 $@(#)$RCSfile: strpbrk.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/05 15:49:04 $@(#)$RCSfile: strdup.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/05 15:48:30 $@(#)$RCSfile: utime.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/05 16:14:54 $@(#)$RCSfile: fseek.c,v $ $Revision: 4.2.9.2 $ (DEC) $Date: 1994/04/04 21:28:42 $@(#)$RCSfile: ftell.c,v $ $Revision: 4.2.9.2 $ (DEC) $Date: 1994/04/04 21:28:58 $@(#)$RCSfile: fgets.c,v $ $Revision: 4.2.7.3 $ (DEC) $Date: 1994/04/05 22:10:03 $@(#)$RCSfile: rand.c,v $ $Revision: 4.2.9.2 $ (DEC) $Date: 1994/08/03 14:33:33 $@(#)$RCSfile: sigsetjmp.c,v $ $Revision: 1.1.9.3 $ (DEC) $Date: 1994/04/05 18:20:01 $@(#)$RCSfile: sigjmp.s,v $ $Revision: 1.1.4.2 $ (DEC) $Date: 1994/04/05 22:25:59 $@(#)$RCSfile: setjmp_incl.s,v $ $Revision: 1.1.4.5 $ (DEC) $Date: 1994/05/13 18:07:02 $@(#)$RCSfile: ldr_atexit.c,v $ $Revision: 4.2.9.2 $ (DEC) $Date: 1994/04/05 15:05:34 $@(#)$RCSfile: catopen.c,v $ $Revision: 4.3.16.3 $ (DEC) $Date: 1995/03/24 18:07:07 $CNLSPATHLANG%/usr/lib/nls/msg/%L/%N;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;@(#)$RCSfile: errlst.c,v $ $Revision: 4.2.7.4 $ (DEC) $Date: 1994/04/05 22:09:37 $Error 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesResource deadlock avoidedNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeOperation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketOption not supported by protocolProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleItem is not local to hostRPC structure is badRPC version is wrongRPC program not availableProgram version wrongBad procedure for programNo locks availableFunction not implementedError number 79 occurredNo message of desired typeIdentifier removedOut of STREAMS resourcesSystem call timed outNext message has wrong typeError in protocolNo message on stream head read qfd not associated with a streamTells open to clone the deviceMounting a dirty fs w/o forceDuplicate package nameVersion mismatchUnresolved package nameUnresolved symbol nameOperation canceledCannot start operationInappropriate operation for file typeOperation in progressToo many timersFunction not implementedInternal AIO operation completeError 101 occurred.Error 102 occurred.Error 103 occurred.Error 104 occurred.Error 105 occurred.Error 106 occurred.Error 107 occurred.Error 108 occurred.Error 109 occurred.Error 110 occurred.Error 111 occurred.Error 112 occurred.Error 113 occurred.Error 114 occurred.Error 115 occurred.Illegal byte sequence@(#)$RCSfile: catgets.c,v $ $Revision: 4.2.10.3 $ (DEC) $Date: 1994/04/05 21:09:37 $@(#)$RCSfile: errno.c,v $ $Revision: 1.1.8.4 $ (DEC) $Date: 1994/04/05 22:09:26 $@(#)$RCSfile: raise.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/05 15:27:58 $@(#)$RCSfile: sigops.c,v $ $Revision: 4.2.10.2 $ (DEC) $Date: 1994/04/05 15:47:12 $@(#)$RCSfile: findiop.c,v $ $Revision: 4.2.10.2 $ (DEC) $Date: 1994/04/04 21:27:54 $@(#)$RCSfile: reentrant_stubs.c,v $ $Revision: 1.1.9.3 $ (DEC) $Date: 1994/04/05 15:28:36 $@(#)$RCSfile: mallocdata.c,v $ $Revision: 1.1.13.2 $ (DEC) $Date: 1995/06/07 21:31:36 $@(#)$RCSfile: NLSsetup.c,v $ $Revision: 1.1.12.2 $ (DEC) $Date: 1995/02/27 19:17:11 $ISO8859-1alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~        !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~.%m/%d/%y%H:%M:%S%a %b %d %H:%M:%S %Y%I:%M:%S %pSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM^[yY].*^[nN].*yes:y:Yno:n:N.%a %b %d %H:%M:%S %Y%m/%d/%y%H:%M:%SAMPMSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecember.yes:y:Yno:n:NISO8859-1@(#)$RCSfile: ecvt.c,v $ $Revision: 4.2.12.4 $ (DEC) $Date: 1994/04/05 22:09:34 $NaNSINFNaNQ@(#)$RCSfile: doprnt.c,v $ $Revision: 4.2.26.2 $ (DEC) $Date: 1995/04/12 13:28:39 $ 0123456789abcdef0123456789ABCDEF0x+-0X(null)LeeeTeeee|eeee8ee@eeedeeeeeeeeeeeeeeeeeedeeeeeeedeeedhg>ך!xup,?Nҍt:wf=`ˣ Uv@WtҨSsuP9_t6#,ՠKMse+Hֹ|r΋{br-qdYp8R4.)i oPPr_n0̵s4mM쨦9x!ma^EYld`@Gk=F j\e9εt jv{e诠=lLi0%r<-6lhVH栂fmg6_l>7lfg *%L!GR`fR2YojU)e88 d.Lj>~Cdx c6uɩ5@0U50b8pt#<7b_Wl4t7 aW7L\r `A,'ޜ?O:`| g29!ؔ_Xn>}|^XYaAB^M^)p/2/]t@ tڈ=Z5: ]n6VBX,Wo\dٌ[CɎYJqc=8[^Cy 5b(,Z CZ;Z,ր+ր+PSpYQ_?|xDŊ>*X S{/ HX. 2S4W hӀ6 hoT\&WPRD;+ :V l+y Vt(>Taӊx}U X˟ň[T HR|DhTȞtdxSiA[htXS %wBRB҆R'q͏/NRGQvlx)iʥHQe']Pl_hH|GP)OE%=daO 0g3 KOFN`ŸN xjTN | OԜM8ד2ʺaM ƀi [HqL tZ e=sLM_{enKSK{L īKL]/7Ā KsǕ=gWJ 0 0 J0΅1J0xKSM IGջ%ʓQI% PR?$CHebÑuH 0 01` H /';hGxҊ*g2G/ cFZ paCR&.`FfGiDE{[̱]SݼD~}?E@& dR3j+Ei0֌@ȻriOD M!>xaDae V?C.袋.z#@Ce*Oo+f9C.6C!MU`B:ElÛ2vp,xBp \9B].AY6Zf`\AC41n8[@ ` ` R@UH2ΟG@ 7N[?F9//*? @ @ Xx9?8 ],> RcV}c>U)|VR2>d! YB=== VĵN=< X1=StAg< , ,_v<oI!.Er6<::{D;)g>ît";1\ALA;?2խ{꛼b: X+` 쳴:QeϧR:i v^::+ qnj9Yi!Y-7i9`ӽ&9{78 5/9 F2588VGJȩb:8U*@W5?#7W?Z5 w7o+&yH\]7 3ƴ7"d{ {6)x9/QI6c6\b¦3~>6s{-9UXB#5!4+P5 ~+m5@Q kFj?(5Q7ϩ\n4D )@۪k@4 ףp= ףGD;]4(1ˢqnCH4|?^Z) 3 P;Ϟ8\M3r+7 U3hr_9ѡE3}7.1k22ȃS'2\~T220+s<(*i2 ؟ ؟5y16x-zt֪1H%e3$[1-S̮1 :_#L/_3A0J띪 0؉؉zTIj0A!).0`ȜB/mD0iKT/ xw/n/Jު(]E/<:oL>t /Wr伴. [琚n>ǗB.3g3bD6c."י\ώ+. Pkz[GK-7XQ痼j- ]OǺØ?C- h P- VA"-_B{ %-6,XuZ9, \.r|,j PG,d lOgd,釸rW+WZ h%P$+)H%Jz+ O ؖG+&%ݒx֞+FEE*|kr?O*\9 ą[(*Z4 Ew*VP*߀*吽뜒ke%w)I$I$I!/ӿ)}yL) ijhaa) P PSm02) ,) 0B̫€R(;>c8ZZbY( |9y(?#qa}NL(xago;(yt'Ur9ǎERm'm5xMę')m' Hi7Rڍ';B'ו?㋍z'=& 6we &#e݌&^UҀJl& ڨRB& Pstn&ZǛJ4pS;0%j$}|%#h8؊2%\F͍xut%FiVpBML% 9it/#%@@ڢ $]nO\d޹g$P:$}$3A:̀ш߅$^$?ˬ~dR8$2vC$@ -o@#~4_g㋻w# 2 U#Ƭ4zDنz#"Wq^U#}K>BZ0#s Z4<=`. #<,a7w$"ew{yr4"4@S4=苞"|5 [ʥz"J/QfV"/]e]XGI3"!B!A@" WM܃6!h3?R0z3+b!ۗUdç!;On3mZ!3uς&:%c! VF[%d] : %.15s @(#)$RCSfile: clnt_udp.c,v $ $Revision: 4.2.10.3 $ (DEC) $Date: 1994/04/05 22:08:45 $clntudp_create: out of memoryP(<t@(#)$RCSfile: pmap_prot.c,v $ $Revision: 4.2.9.2 $ (DEC) $Date: 1994/04/05 15:25:52 $@(#)$RCSfile: xdr.c,v $ $Revision: 4.2.8.2 $ (DEC) $Date: 1994/04/05 16:35:01 $xdr_bytes: out of memoryxdr_string: out of memory@(#)$RCSfile: siad_niscore.c,v $ $Revision: 1.1.4.2 $ (DEC) $Date: 1995/03/28 01:03:53 $@(#)$RCSfile: innetgr.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/04 21:43:35 $netgroup.byusernetgroup.byhost innetgr: recursive overflow innetgr: netgroup %s called recursively #innetgr: syntax error in /etc/netgroup netgroup*@(#)$RCSfile: ndbm.c,v $ $Revision: 4.2.17.2 $ (DEC) $Date: 1995/04/06 20:54:01 $.dir.pag@(#)$RCSfile: getnetgrent.c,v $ $Revision: 4.2.9.2 $ (DEC) $Date: 1994/04/04 21:30:41 $getnetgrent: getdomainname system call missing #Cycle detected in /etc/netgroup: %s. --- %s syntax error in /etc/netgroup @(#)$RCSfile: siad_init.c,v $ $Revision: 1.1.13.3 $ (DEC) $Date: 1994/04/05 17:49:42 $@(#)$RCSfile: sia_globals.c,v $ $Revision: 1.1.9.3 $ (DEC) $Date: 1994/04/05 17:48:28 $BSDDCEX.509OSFC2NISsiad_initsiad_chk_invokersiad_ses_initsiad_ses_authentsiad_ses_estabsiad_ses_launchsiad_ses_suauthentsiad_ses_reauthentsiad_chg_fingersiad_chg_passwordsiad_chg_shellsiad_getpwentsiad_getpwuidsiad_getpwnamsiad_setpwentsiad_endpwentsiad_getgrentsiad_getgrgidsiad_getgrnamsiad_setgrentsiad_endgrentsiad_ses_releasesiad_chk_user@(#)$RCSfile: sia_mat_init.c,v $ $Revision: 1.1.13.4 $ (DEC) $Date: 1994/05/27 20:30:50 $File %s not foundlibc.cat/etc/sia/matrix.confERRORrCan't close matrix file %s Can't open matrix file %sBad matrix file format in %s @(#)$RCSfile: libdl_dummy.c,v $ $Revision: 1.1.9.2 $ (DEC) $Date: 1994/04/05 15:06:13 $The shared-library loader API is not supported for non_shared executables.@(#)$RCSfile: sia_log.c,v $ $Revision: 1.1.26.2 $ (DEC) $Date: 1995/03/28 01:02:47 $ SIA:%s %sa/var/adm/sialog@(#)$RCSfile: sia_getmsg.c,v $ $Revision: 1.1.9.2 $ (DEC) $Date: 1995/03/28 01:02:43 $@(#)$RCSfile: NLgetamsg.c,v $ $Revision: 4.2.9.4 $ (DEC) $Date: 1994/04/05 21:53:00 $locking error on exception resources shared among threadsexception dispatch or unwind stuck in infinite loopunwindingdispatcher context corrupted on collided unwindtried to continue non-continuable exceptioninvalid argument to exception system routinehandler returned invalid dispositionencountered invalid exception recordhandler expected valid signal valueout of memory trying to allocate exception system resourcesstack overflowruntime function entry or table not foundunsupported functionality@(#)$RCSfile: vsprintf.c,v $ $Revision: 4.2.9.2 $ (DEC) $Date: 1994/04/05 16:32:56 $@(#)$RCSfile: sigcompat.c,v $ $Revision: 4.2.10.2 $ (DEC) $Date: 1994/04/05 15:46:37 $@(#)$RCSfile: alarm.c,v $ $Revision: 4.2.6.3 $ (DEC) $Date: 1994/04/05 21:09:02 $@(#)$RCSfile: waitpid.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/05 16:33:22 $@(#)$RCSfile: rpccommondata.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/05 15:30:04 $@(#)$RCSfile: pmap_getport.c,v $ $Revision: 4.2.9.2 $ (DEC) $Date: 1994/04/05 15:25:46 $@(#)$RCSfile: xdr_mem.c,v $ $Revision: 4.2.9.2 $ (DEC) $Date: 1994/04/05 16:35:18 $@(#)$RCSfile: rpc_prot.c,v $ $Revision: 4.2.9.2 $ (DEC) $Date: 1994/04/05 15:29:57 $Ԋऊఊ༊Ȋ@(#)$RCSfile: bresvport.c,v $ $Revision: 4.2.6.3 $ (DEC) $Date: 1994/04/05 21:09:28 $@(#)$RCSfile: auth_none.c,v $ $Revision: 4.2.8.3 $ (DEC) $Date: 1994/04/05 21:09:20 $@(#)$RCSfile: rpcdtablesize.c,v $ $Revision: 4.2.7.2 $ (DEC) $Date: 1994/04/05 15:44:31 $@(#)$RCSfile: fdopen.c,v $ $Revision: 4.2.9.3 $ (DEC) $Date: 1994/04/05 22:09:55 $@(#)$RCSfile: lockf.c,v $ $Revision: 4.2.10.2 $ (DEC) $Date: 1994/04/05 15:06:34 $exception system: exiting due to internal error: %s @(#)$RCSfile: setjmp_incl.s,v $ $Revision: 1.1.4.5 $ (DEC) $Date: 1994/05/13 18:07:02 $@(#)$RCSfile: alpha_unwind.c,v $ $Revision: 1.1.12.4 $ (DEC) $Date: 1994/04/05 18:19:44 $hhhhhhhhhhhhhhhhhhhhhhhh,,,,hh<<Lhhh\hhhhhhhhhhhUnable to convert `%s' to a bind address. Reverting to ANY. %s:%u: failed assertion `%s' connect.cconnection_host_name == NULLconnection_host_name != NULLConnecting to %s[%s]:%hu... Connecting to %s:%hu... Closing fd %d connected. Created socket %d. failed: %s. Master socket fd %d bound. using port %i. .ACreated socket fd %d. Apparently %s has been removed. Scanning %s (from %s) will convert url %s to local %s will convert url %s to complete Converted %d files in %.2f seconds. @@Converting %s... nothing to do. Cannot convert links in %s: %s Unable to delete `%s': %s wbSomething strange is going on. Please investigate.Skipping %s at position %d. TO_RELATIVE: %s to %s at position %d in %s. TO_COMPLETE: to %s at position %d in %s. %d-%d %s:%u: failed assertion `%s' convert.c*s1 != '/'../orig.origCannot back up %s as %s: %s %d; URL=%sto - newname == fsqlen/index.htmlfile != NULLDeleted old cookie (to be replaced.) Stored cookie %s %d%s %s %s %d %s %s %s (ANY)permanentnonpermanent%s:%u: failed assertion `%s' cookies.cres != 0Discarded old cookie. name_b != NULL && name_e != NULLdomainpathexpiresmax-age%lfsecureError in Set-Cookie, field `%s'Syntax error in Set-Cookie: %s at position %d. ||l}}L~~~ cdm: 1 2 3 4 5 6.int.mil.gov.org.net.edu.com 7 8Cookie coming from %s attempted to set domain to %s Attempt to fake the path: %s, %s ocnt == countCookie: pos == result_sizerCannot open cookies file `%s': %s TRUE?:%d %s %s %s %.0f %s %s FALSESaving cookies to %s. w# HTTP cookie file. # Generated by Wget on %s. # Edit at your own risk. Error writing to `%s': %s Error closing `%s': %s Done saving cookies. byte%s:%u: failed assertion `%s' ftp.ccon != NULLcon->target != NULL!((cmd & DO_LIST) && (cmd & DO_RETR))(cmd & (DO_LIST | DO_CWD | DO_RETR | DO_LOGIN)) != 0user && passwd%s@%sLogging in as %s ... Error in server response, closing control connection. Closing fd %d Error in server greeting. Write failed, closing control connection. The server refuses login. Login incorrect. Logged in! ==> SYST ... Server error, can't determine system type. done. ==> PWD ... /Initial VMS directory not in the form [...]! Preprocessing the initial VMS directory old = '%s' new = '%s' done. ==> TYPE %c ... Unknown type `%c', closing control connection. done. ==> CWD not needed. changing working directory Prepended initial PWD to relative path: pwd: '%s' old: '%s' new: '%s' *ntarget == '/'Changed file name to VMS syntax: Unix: '%s' VMS: '%s' ==> CWD %s ... No such directory `%s'. ==> CWD not required. ==> SIZE %s ... ==> PASV ... Cannot initiate PASV transfer. Cannot parse PASV response. couldn't connect to %s:%hu: %s ==> PORT ... socket: %s Bind error (%s). Invalid PORT. ==> REST %ld ... REST failed; will not truncate `%s'. REST failed, starting from scratch. ==> RETR %s ... No such file `%s'. ==> LIST ... No such file or directory `%s'. .Lying FTP server found, adjusting. accept: %s abwb%s: %s Length: %s [%s to go] (unauthoritative) %s: %s, closing control connection. %s (%s) - Data connection: %s; %s (%s) - Control connection closed. Data transfer aborted. r%s ܧLద,థ08((((((ึ(((((((((((((((ష(((((((((((((((0 ȺFile `%s' already there, not retrieving. (try:%2d)--%s-- %s %s => `%s' %s (%s) - `%s' saved [%ld] %s URL: %s [%ld] -> "%s" [%d] Removing file due to --delete-after in ftp_loop_internal(): Removing %s. unlink: %s .listingUsing `%s' as listing tmp file. Removed `%s'. Recursion depth %d exceeded max. depth %d. f != NULLRemote file no newer than local file `%s' -- not retrieving. Remote file is newer than local file `%s' -- retrieving. The sizes do not match (local %ld) -- retrieving. Invalid name of the symlink, skipping. Already have correct symlink %s -> %s Creating symlink %s -> %s symlink: %s Skipping directory `%s'. %s: unknown/unsupported file type. %s: corrupt time-stamp. Unrecognized permissions for %s. Will not retrieve dirs since depth is %d (max %d). %s%s%s/%sComposing new CWD relative to the initial directory. odir = '%s' f->name = '%s' newdir = '%s' Not descending to `%s' as it is excluded/not-included. ../Rejecting `%s'. No matches on pattern `%s'. Wrote HTML-ized index to `%s' [%ld]. Wrote HTML-ized index to `%s'. %s %s%s%s PASS--> %s --> PASS Turtle Power! --> %s USER331 opiekey 331 s/key %d,%d,%d,%d,%d,%dPORTPASVTYPECWDRESTRETRLISTSYSTVMSUNIXWINDOWS_NTMACOSOS/400PWD"SIZEtype=DecNovOctSepAugJulJunMayAprMarFebJanrb%s: %s total PLAINFILE; DIRECTORY; SYMLINK; UNKNOWN; implicit perms %0o; perms %0o; month: %s; day: %d; year: %d (no tm); time: %02d:%02d:%02d (no yr); -> link to: %s ... Ignoring `.' and `..'; trailing `/' on dir. trailing `@' on link. trailing `*' on exec. Skipping. Name: '%s' -:MYYYY/MM/DD HH:MM - %d/%02d/%02d %02d:%02d Timestamp: %ld Directory File, size %ld bytes wrong VMS permissons! DECNOVOCTSEPAUGJULJUNMAYAPRMARFEBJANfile name: '%s' .DIRFile Getting additional line empty line read, leaving listing parser confusing VMS listing item, leaving listing parser second token: '%s' day: '%s' nonsense in VMS listing, skipping this line date parsed YYYY/MM/DD HH:MM:SS - %d/%02d/%02d %02d:%02d:%02d ,)confusing VMS permissions, skipping line permissions: %s -> 0%o Unsupported listing type, trying Unix listing parser. wb%s%s%s@ �Index of /%s on %s:%d� 

  %d %s %02d %02d:%02d         time unknown       File        Directory   Link        Not sure    %s  (%s bytes)-> %s(nil)
store is `%s' POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument );Ok[WQ /?!"i,9Ka~j e7 CA f!*7H}P^zKd5U_ %/^k=OG[)6FI\( QK55>n)#5Fu[~Tv>ԙwQ???%s %s:%u: failed assertion `%s' host.cindex >= al->faulty && index < al->countindex == al->faultycount > 0Releasing %p (new refcount %d). Deleting unused %p. Caching %s => %s Found %s in host_name_addresses_map (%p) Resolving %s... failed: %s. failed: timed out. %s, , ...u->host != NULLHost not foundUnknown erroral->refcount == 1ltgtampquotnbsp%s:%u: failed assertion `%s' html-parse.cto - (pool->contents + pool->tail) <= end - begch == '\'' || ch == 0x22ch == quote_charch == '-'qqqqdrPssss@tr ssss(r(rs(r(r(r(r(r(r(r(r(r(r(r(r(r(r(r(r(r(rs(r r(r(r(r(r r(r(r(r(r(rlr(r(r(r(r(r(r(r(r(r(r(r(r(r(r(r(rrthtdtablescriptoverlaymetalinklayerinputimgiframeframeformfigembedbodybgsoundbaseareaappletalowsrcbackgroundsrccodehrefactioncontentnamehttp-equivrel%s: no base, merge will use "%s". %s: Cannot resolve incomplete link %s. %s: link "%s" doesn't parse. %s: merge("%s", "%s") -> %s %s: merged link "%s" doesn't parse. appending "%s" to urlpos. %s:%u: failed assertion `%s' html-url.cfirst != -1stylesheetshortcut iconrefreshrobotsnonenofollowt != NULL%s: %s Loaded %s (size %ld). no-follow in %s: %d %s: Invalid URL %s: %s HTTP/%s:%u: failed assertion `%s' http.csock > -1 || ssl != NULLsock == -1 || ssl == NULL[writing POST file %s ... rbwritten == promised_sizedone] bytesnoneKeep-Alivewget_cookie_jar != NULLInvalidating fd %d from further reuse. Closing fd %d pc_last_host_ip == NULLpc_last_host_ip != NULLRegistered fd %d for persistent reuse. *hs->local_file != NULLReusing connection to %s:%hu. Reusing fd %d. HEADPOSTGETReferer: %s Pragma: no-cache Range: bytes=%ld- Wget/%sAuthorizationProxy-Authorization:%dConnection: Keep-Alive Content-Type: application/x-www-form-urlencoded POST data file missing: %s Content-Length: %ld %s %s HTTP/1.0 User-Agent: %s Host: %s%s%s%s Accept: %s %s%s%s%s%s%s%s%s%s%s []*/*---request begin--- %s[POST data: %s] ---request end--- Failed writing HTTP request: %s. %s request sent, awaiting response... ProxyHTTP End of file while parsing headers. Read error (%s) in headers. No data receivedMalformed status line(no description) %2d %s%2d %sContent-LengthContent-TypeLocationLast-ModifiedSet-CookieWWW-AuthenticateAccept-RangesContent-RangeConnectioninhibit_keep_alive == 0Authorization failed. Unknown authentication scheme. BasicLocation: %s%s unspecified [following]text/htmlapplication/xhtml+xml.htm.html The file is already fully retrieved; nothing to do. Continued download failed on this file, which conflicts with `-c'. Refusing to truncate existing file `%s'. Length: (%s to go)ignored [%s] abwb%s: %s Warning: wildcards not supported in HTTP. File `%s' already there, will not retrieve. .orig (try:%2d)--%s-- %s %s => `%s' Cannot write to `%s' (%s). Unable to establish SSL connection. ERROR: Redirection (%d) without location. %s: %s ERROR %d: %s. Last-modified header missing -- time-stamps turned off. Last-modified header invalid -- time-stamp ignored. Server file no newer than local file `%s' -- not retrieving. The sizes do not match (local %ld) -- retrieving. Remote file is newer, retrieving. %d %s %s (%s) - `%s' saved [%ld/%ld] %s URL:%s [%ld/%ld] -> "%s" [%d] %s (%s) - `%s' saved [%ld] %s URL:%s [%ld] -> "%s" [%d] %s (%s) - Connection closed at byte %ld. %s (%s) - `%s' saved [%ld/%ld]) %s (%s) - Connection closed at byte %ld/%ld. %s (%s) - Read error at byte %ld (%s).%s (%s) - Read error at byte %ld/%ld (%s). HHxH8HHH%a %b %d %T %Y%a, %d-%b-%Y %T%A, %d-%b-%y %T%a, %d %b %Y %T%s:%s%s: Basic %s 0123456789abcdefnonceopaquerealm:Authorization: Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", opaque="" DigestNTLMwaitretrywaitverboseuseragentuseproxytriestimestampingtimeoutstrictcommentsspiderspanhostsserverresponsesaveheaderssavecookiesrobotsretryconnrefusedretrsymlinksrestrictfilenamesremovelistingrelativeonlyrejectrefererrecursivereclevelreadtimeoutrandomwaitquotaquietproxyuserproxypasswdprogresspostfilepostdatapasswdpassiveftppagerequisitesoutputdocumentnumtriesnoproxynoparentnoclobbernetrcmirrorloginlogfileloadcookieslimitratekilllongerinputincludedirectoriesignoretagsignorelengthhttpuserhttpsproxyhttpproxyhttppasswdhttpkeepalivehtmlifyhtmlextensionheaderglobftpproxyforcehtmlfollowtagsfollowftpexcludedomainsexcludedirectoriesdotstyledotspacingdotsinlinedotbytesdomainsdnstimeoutdnscachedirstructdirprefixdeleteafterdebugcutdirscookiesconvertlinkscontinueconnecttimeoutcachebindaddressbasebackupsbackupconvertedbackgroundalwaysrestaddhostdiracceptanonymous-wget@no_proxy @HOMEWGETRC%s: WGETRC points to %s, which doesn't exist. %s/.wgetrcrb%s: Cannot read %s (%s). %s: Error in %s at line %d. /usr/local/etc/wgetrc%s: Warning: Both system and user wgetrc point to `%s'. %s:%u: failed assertion `%s' init.c0 <= comind && comind < countof (commands)%s: Invalid --execute command `%s' %s: %s: Invalid boolean `%s', use `on' or `off'. alwaysnever%s: %s: Invalid boolean `%s', use always, on, off, or never. %s: %s: Invalid number `%s'. inf@0AApB?%s: %s: Invalid byte value `%s' %s: %s: Invalid time period `%s' ?N@ @@u"AxhXP%s: %s: Invalid header `%s'. %s: %s: Invalid progress type `%s'. unixwindowsnocontrol%s: %s: Invalid restriction `%s', use `unix' or `windows'. %s: %s: Invalid value `%s'. ?$@awwget-log %s received, redirecting output to `%s'. %s: %s; disabling logging. Usage: %s [OPTION]... [URL]... GNU Wget %s, a non-interactive network retriever. Mandatory arguments to long options are mandatory for short options too. Startup: -V, --version display the version of Wget and exit. -h, --help print this help. -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. Logging and input file: -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print debug output. -q, --quiet quiet (no output). -v, --verbose be verbose (this is the default). -nv, --non-verbose turn off verboseness, without being quiet. -i, --input-file=FILE download URLs found in FILE. -F, --force-html treat input file as HTML. -B, --base=URL prepends URL to relative links in -F -i file. Download: -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). --retry-connrefused retry even if connection is refused. -O --output-document=FILE write documents to FILE. -nc, --no-clobber don't clobber existing files or use .# suffixes. -c, --continue resume getting a partially-downloaded file. --progress=TYPE select progress gauge type. -N, --timestamping don't re-retrieve files unless newer than local. -S, --server-response print server response. --spider don't download anything. -T, --timeout=SECONDS set all timeout values to SECONDS. --dns-timeout=SECS set the DNS lookup timeout to SECS. --connect-timeout=SECS set the connect timeout to SECS. --read-timeout=SECS set the read timeout to SECS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1...SECONDS between retries of a retrieval. --random-wait wait from 0...2*WAIT secs between retrievals. -Y, --proxy=on/off turn proxy on or off. -Q, --quota=NUMBER set retrieval quota to NUMBER. --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. --limit-rate=RATE limit download rate to RATE. --dns-cache=off disable caching DNS lookups. --restrict-file-names=OS restrict chars in file names to ones OS allows. Directories: -nd, --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. HTTP options: --http-user=USER set http user to USER. --http-passwd=PASS set http password to PASS. -C, --cache=on/off (dis)allow server-cached data (normally allowed). -E, --html-extension save all text/html documents with .html extension. --ignore-length ignore `Content-Length' header field. --header=STRING insert STRING among the headers. --proxy-user=USER set USER as proxy username. --proxy-passwd=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. -s, --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --cookies=off don't use cookies. --load-cookies=FILE load cookies from FILE before session. --save-cookies=FILE save cookies to FILE after session. --post-data=STRING use the POST method; send STRING as the data. --post-file=FILE use the POST method; send contents of FILE. FTP options: -nr, --dont-remove-listing don't remove `.listing' files. -g, --glob=on/off turn file name globbing on or off. --passive-ftp use the "passive" transfer mode. --retr-symlinks when recursing, get linked-to files (not dirs). Recursive retrieval: -r, --recursive recursive download. -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). --delete-after delete files locally after downloading them. -k, --convert-links convert non-relative links to relative. -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut option equivalent to -r -N -l inf -nr. -p, --page-requisites get all images, etc. needed to display HTML page. --strict-comments turn on strict (SGML) handling of HTML comments. Recursive accept/reject: -A, --accept=LIST comma-separated list of accepted extensions. -R, --reject=LIST comma-separated list of rejected extensions. -D, --domains=LIST comma-separated list of accepted domains. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. -G, --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. -X, --exclude-directories=LIST list of excluded directories. -np, --no-parent don't ascend to the parent directory. Mail bug reports and suggestions to . waitretrywaituse-proxyrefereruser-agenttriestimeoutsave-cookiesrestrict-file-namesrejectread-timeoutquotaproxy-userproxy-passwdproxyprogresspost-filepost-dataoutput-fileoutput-documentnoload-cookieslimit-ratelevelinput-fileinclude-directoriesignore-tagshttp-userhttp-passwdhtmlifyheaderglobfollow-tagsexclude-domainsexclude-directoriesexecutedot-styledomainsdns-cachedirectory-prefixdns-timeoutcut-dirscookiesconnect-timeoutcachebind-addressbasebackupsappend-outputacceptversionverbosetimestampingstrict-commentsspiderspan-hostsserver-responsesave-headersretry-connrefusedretr-symlinksrelativerecursiverandom-waitquietpage-requisitespassive-ftpnon-verboseno-parentno-http-keep-aliveno-host-lookupno-host-directoriesno-directoriesno-clobbermirrorignore-lengthhtml-extensionhelpforce-htmlforce-hierforce-directoriesfollow-ftpdont-remove-listingdelete-afterdebugconvert-linkscontinuebackup-convertedbackgroundhpVqvdkKsxmNWrHSLcFbEY:G:g:T:U:O:l:n:i:o:a:t:D:A:R:P:B:e:Q:X:I:w:C:onnoparentdeleteafterretrsymlinksignorelengthpassiveftpnoclobberfollowftpcutdirsoffdirstructaddhostdirremovelistingbindaddresshttpkeepaliverandomwaithtmlextensionforcehtmlspanhostsbackupconvertedconvertlinksrelativeonlypagerequisitesserverresponsesaveheadersGNU Wget %s %sCopyright (C) 2003 Free Software Foundation, Inc. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. Originally written by Hrvoje Niksic . retryconnrefusedstrictcommentshttpuserhttppasswddotstyleexcludedomainsproxyuserproxypasswdfollowtagsloadcookiessavecookieslimitratepostdatapostfilednscacherestrictfilenamesdnstimeoutreadtimeoutconnecttimeoutlogfileignoretagsincludedirectoriesinputreclevel%s: illegal option -- `-n%c' Try `%s --help' for more options. outputdocumentdirprefixuseragentexcludedirectoriesuseproxyCan't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. %s: missing URL DEBUG output created by Wget %s on %s. osf3.2abwbRemoving file due to --delete-after in main(): Removing %s. unlink: %s No URLs found in %s. FINISHED --%s-- Downloaded: %s bytes in %d files Download quota (%s bytes) EXCEEDED! D((@%x%%%8"D"%P"%(t""("''''"''"(( ((((((((P%" ","%(%\"%("&"&'""""'(x#(#((((((((###4!@!#$L!X!d!p!$|!! $0$!!!!!(@$P$`$(!!$((p$$$$$"($$(((((#$%#% %0%p&&&&&&&&&&&&&&&&&&&&&&&&&&&&|&&&&&&&&&&&&&&&&&&d&SIGUSR1WTF?!SIGHUP%s/%s.netrcr%s: Cannot read %s (%s). loginpasswordmacdefaccount%s: %s:%d: warning: "%s" token appears before any machine name defaultmachine%s: %s:%d: unknown token "%s" LLlKLKKbardot %*s[ skipping %dK ] %5ldK ,%s:%u: failed assertion `%s' progress.cdp->dots < opt.dots_in_line%3d%%Y@ %s. defaultbinarymegagigaInvalid dot style specification `%s'; leaving unchanged. i@b@percentage <= 100%2d%% 100% dlsz <= progress_sizeinsz <= dlsz %-11sG/sM/sK/sB/s %7.2f%s --.--K/s ETA %02d:%02d ETA %d:%02d:%02d p - bp->buffer <= bp->widthY@p@ @@@|jYH TERMforceemacsEnqueuing %s at depth %d Queue count %d, maxcount %d. Dequeuing %s at depth %d %s: %s. Already downloaded "%s", reusing it from "%s". Not descending further; at depth %d, max. %d. %s:%u: failed assertion `%s' recur.curl_parsed != NULLRemoving file due to %s in recursive_retrieve(): --delete-afterrecursive rejection criteriaRemoving %s. Removing %s since it should be rejected. unlink: %s Deciding whether to enqueue "%s". Already on the black list. Not following non-HTTP schemes. It doesn't really look like a relative link. The domain was not accepted. Going to "%s" would escape "%s" with no_parent on. %s (%s) is excluded/not-included. %s (%s) does not match acc/rej rules. This is not the same hostname as the parent's (%s and %s). Not following %s because robots.txt forbids it. Decided to load it. Decided NOT to load it. orig_parsed != NULLnew_parsed != NULLRedirection "%s" failed the test. wget%s:%u: failed assertion `%s' res.cj == cnt!EOL (p)Ignoring malformed line %duser-agentallowdisallowIgnoring unknown field at line %dCannot open %s: %s%s path %s because of rule `%s'. AllowingRejecting/robots.txtLoading robots.txt; please ignore errors. deferring a %.2f ms sleep (%ld/%.2f). sleeping %.2f ms for %ld bytes, adjust %.2f ms @@i@GB/sMB/sKB/sB/s%7.2f %s%.2f %s%s:%u: failed assertion `%s' retr.cmsecs >= 0bytes >= 0@@@0AP?A>>%s: %s. Error parsing proxy URL %s: %s. Error in proxy URL %s: Must be HTTP. mynewloc != NULL%d redirections exceeded. Removing file due to --delete-after in retrieve_from_file(): Removing %s. unlink: %s Giving up. Retrying. sleep_between_retrievals: avg=%f,sleep=%f .A%s.%dhttp_proxyftp_proxyCBBBBQ00000000000000000000000000000000  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~DlȦ4HЧ0XԬదࠦฦਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬਬ`ਬਬਬਬਬਬਬਬਬਬ,Ȫਬਬਬਬਬ फਬਬ`ਬਬबd0123456789ABCDEF0123456789abcdef?$@?gfffffffftp://http://0123456789ABCDEF%s:%u: failed assertion `%s' url.cp2 - newstr == newlen@/?#;ftp://%shttp://%sInvalid IPv6 numeric addressIPv6 addresses not supportedUnterminated IPv6 numeric addressInvalid user nameBad port numberEmpty hostUnsupported schemeNo error:/;?#/;?#;?#?##*p == 0error_code >= 0 && error_code < countof (parse_errors)Removing %s because of directory danger! %s: %sq - TAIL (dest) == outlenindex.html?;#scheme_str != NULL*password*p - result == size%s: %s: Not enough memory. mallocreallocstrdup%02d:%02d:%02d%04d-%02d-%02d %02d:%02d:%02dwget-logforkContinuing in background, pid %d. Output will be written to `%s'. /dev/nullrwutime(%s): %s Unlinking %s (symlink). Failed to unlink symlink `%s': %s rbhtmlhtm1%ldgfffffffgfffffff ףp= ףS㥛 KY8m4 k)4ׂCBzՔ0ˆ;U T& .vHW:o$ rN 3"[3/#?zZЄK8Ƥ~͕PMB @zZo#mVX{HƤ~]xEcWx/e9o#c %ZR;\]xEcC]rd @@?<,,?@@.AeA%s:%u: failed assertion `%s' utils.csig == SIGALRM.A1.9V - - - - - - .  . @. .  . (. 0. S <. D2 L6   R P: H@W PJ XJ `J 0S hJ pJ xJ J J J J J J J J W J J J J K K K  K (K 0K 8K @K HK PK XK hK xK K K K K K K K K K K K K K K K L L L  L (L 0L 8L HL PL `L pL xL  @L L L L L L L  XW L L L L L L L L L M M M M  M `Y (M 0M HM XM hM pM xM M M M M M M M M M M M M M N N N N  N (N 0N 8N @N HN PN XN `N hN xN N N N N N N N N N N N N N O O O  O (O 0O 8O  0 0  0    @O HO PO XO `O hO     ( 0 @ X h     Е     ( 8 H X h x     !L=0"@"P"D='L=(L=(L=)L= *L=`-L=@.L=.L=@2L=`3L=@4L= 5L=5L=6L=`7L=`:L=?L=`BL=`EL=GL= HHD=JD= LD=LD=MD=`OD=PD=QD=RD=`SD=SD=UD=@UD=UL=VL=`VL= WL=XL=YL=@[L=_L=dL=fL=@jL=jL= lL=@mL=mL=nL=`oL=ppD= vD=wD=}D= D=`D=D=pD=D=D=PD=0D=оD=D=D=D=0D=D=L=`L=L=L=L=L=`L=L=@L=L=@L=L=`L=L=pL=pL=L=L=0L=L=L=L= @ D= D=p<=<=<='<=P'<='<='<=@(<=)<=)<=*<=,<=-<=.<=`0<=`2<=2<=33 4,=`4,=4,=@5,=5,=5`6p6=9=P:=P;=;;< <=<=`====?=?= @=@=A= B=B=B=@CCD<@D<D<E<@F<H<I<K<@K<K< L<`U<XY<Z<@e<g<@h<@k<@m< n<n<o<@s<s<u< y<y< |<~<<<<@<<`<< << <<<<< <<<<< <@<<@<< <<<<`<<`<@<<<< <<< <<<<<@<`<<<<@< <<@<<`<<<< <<@<< < <<<`<<<@<<<<<@<<<`<`<<P<<@<`<<(<@+< ,,<2<@3< 4<`5<5<6<@6<6<8<@9<9<;<=<@?< @< A<A<B<L<M<N<O O@O`O<O<@P<PP<0Q<pQ<R<S<Z<0`<a<b<c<d<j<j<k<n<o<p<r<r<Ps<s<s<pu<x<Py<z<p<Ѓ<0<<0<0<P<<@<<<<@< `<<<<< <`<@< < <`<< < <@<<<<<`<<@<`<@<<@<<`<`<@<<`<< `<<<@P<<0<<<<<0<<<<<<<P<<<p<<<0<<P<0<<P<<0<p<<p<p<<p<<0<<0<p<<<p<<<<<P<<<P<<<0<p<<P<p<<<P<<p<<P<P<< < < < < < <P < <<`<<<<P= ===P$=,=,=,=4=<= <=<=<=@<= <=#<=p%<=&<=*<=,<=@0<=2<=2<=3<=03<=7<= 9<=;<=0;<==<=><=`A<=A<=A<=B<= D<=F<= I<=J<=K<=0N<=pN<=ND=PL=PT=R\=`Xd=Xd=Zd=[d=]d=^d=ad=cd=dd=il=`jl= kl=mt=Pnt=nt=o|=p=q=q=q=0t=u=Px=`y=0{={=|=}=}=}=~=P~=~=~=`==>P>>Ї >@>0>>p>p$>Ў<><> <><> <><><>P<><><><>О<><>p<>С<><><><><> <><><>0<>D>D>D> L>T>T>T>\>d> d>@d> d>d>d>d>Pl>t>t>0t>t>t>P|>>>>0>p>>>>>0>??$?,?P4?<@@@<@<@p<@`<@ЌD@pD@D@`D@D@D@D@D@D@L@0L@L@L@L@`L@L@ T@\@@\@\@`\@\@\@\@ d@`l@l@pl@l@l@l@Pl@t@0t@t@t@ t@ t@t@t@t@t@t@t@0t@t@P t@!|@"|@p$|@%|@p)|@P*|@+|@0-|@7|@`8@8@:@p=@>@@?@p?@?@0@@@@A@@A@C@PE@E@E@F@0F@PF@pF@F@`G@G@H@`H@PI@I@K@L@PL@`M@M@@N@N@O@O@P@0U@Y@Z@P\@ ]@_@P`@`@`@@a@0b@pbAb A@fA`fAfA gAgAgAhAhA@lAlAq$A`v,Av,A0w,Ay4A{" 'RBAB½#RF3aB?GGG=G]G}}`@[k '½#/}`@[k 't½#/}`@[k '\½#H}`@[k 'H½#G//GG/]=}GGx@G= G}`@[k '#p}@#kG/kG/GG/G/ '#>C^>^~ ( F 1F@F ] G" AG?4 A",A"H'H BD30@F@F@ @ U@. áu@ @ 4@A",A"H'H ",A"H'H%@  4@A",A"H'H%@  QA *,A*H'H%@ P@F 4 A",A"H'H BD4@A",A"H'H$@ 4@A",A"H'H%@ QA *,A*H'H%@ 4 A",A"H'H BD@U@"D 0@F/G/`4@A",A"H'H%@n @ 4@A",A"H'Hg 4 A",A"H'H BD 4@A@U@"D?7@J8@D@@D 4 A",A"H'HD !D)5 A4@ABD",A"H'HI u@ @FG/cD",A"H'H-@ )EJEA[_j 4@A4@A#,A#H'H?24@A",A"H'H- ",A"H'H%@ QA% *,A*H'H%@ )E 4 A G/4`@",A"H'H+@ BD`4`@",A"H'H? `4`@",A"H'H 4@A",A"H'Hu+@e 4Gp4 A#,A#H'H5$@+@ADF4 A",A"H'H BD7@J8 D0 D0@F4@A/G/DD@(D 4 A",A"H'HD BD4 AA,BAHGH !D@7D?@ 4 A#,A#H'HK@ BD cD@(D 4 A",A"H'H BD4 A",A"H'H BD',A'H'H F@ E@ @?á@ 7@J8 D0 D4 A",A"H'H@#D A@@?4@A",A"H'H@? 4@A4 A",A"H'H BD4@A",A"H'H4G D^>^~ (CkG '0#>C^>^= !" a]! 4G/GG@/ D 4G=&h1"JGGu@G)EG]"/GD@/)EG/GE@] 4G"^>^Ck 'p#>C^> F )IЀ}G@G ^>CkG/G/G/ '#>C^> ^s^؀=CG/G@] G" $>4 @ ] " @ G"$^CkG/G/G/G 'p#>C^= ! &"=&ğ1"G}&Οs"/G@/= ! &"=&ğ1"4G}&s"/G@/= ^CkG/ 'й#>C^>^~ F 1F RF=C!JE)EG/GE@#)EG/GF@ D}! )E/G@G G=&1"K)E_AG/Glt@ G=&%1")E_AG/Gbt@=4GG }GG`@ Dn@a} C? A@@D #@>?@!  ? @>JE?"1&_"CG(}GX@G_= ! C=)E!G}"/GDE@G/GE@/JE)ED8}GGN@ JE@}GGX@Ӑa= !GG/GE@Ӑa=!JECDpi,_JE@}GGD@Ӵ)G/G &>"JEG/GBt@_!@G=&M1"G/Gs@Ӑa= ! &Y"JEG/G.t@G/G= ! )EP}GG(@G=&m1"DG/Gs@= !JE^>^~ CkG/G/G/ '#>C^>^~ ( F 1F RFCCG/GC@0>4> !A C/kE)EJE/GC@/JEEE_ kE)EG/GC@ 0 A4> !A? ^>^~ (CkG '##^> FC?"G/GH@Ӄ IE~@@D#E4G"H#"D#0 ACGG"p}Gl@/@^> #kG/ '#>C^>^~ F4G0> (=%`)!? )1F4GG }GZ@G @ =$`! ?"1&GCG(}GGZ@TG_=!+,+H0v H}GB@/= !}"C)ED DG/G"*G/GNs@]$`B ? "4GmÐa= ! =$`! &z"!G/G")GGs@G/G/]$`B ? "G5C/GLD@G+,A+Hq H!F+>a= ! &"+JG/Gr@G/=%`)! 4G}GGط@ @}GG@Ӑa= ! &>")G/Gr@]$`B ? "tGTG^>^~CkG/G '##^>^^ F1^ RF(0C?"G/GB@Ӄ@ID~@@DCE4G"AH#"D#(> 0^ "EC[8~8 ["JX=$! ABJX[_$^=!) @ 0@A(>0^G "p}GGP@] G"^>^^@#kG '#>C^> FG/GC@=$`! a] p"G_ =$`! ] "C}Gd@G @ G Ða= ! &")G/G^r@G^>CkG/G/G/G '#>C^> F4 A @}GG<@Ӑa= ! &>")EG/G")GG(r@G/]$`B ? "^>CkG/G/ 'Ю#>C^> 1FG >CC}GG@G>!v HU @ C)E/GnC@/4Gø}G@G^>CkG/G '0#>C^>^~ ( F 1F RFa= `!?Z@G_ !ҝ!, @ )EkEJE}GG&@@ @?^>^~ (CkG/G 'p#>C^>^~ (0޵ F 1F RFG a!`.?Z@E4G_ !}!+ @ EJE)Eȁ}GG@@ @? @A) A?^>^~ (0ޥCkG/ '#>C^>^~ (0޵8@^H~PG/G@X=! GG@G D{= EG/G~<@ D a] "l &ؠ"EG/GZq@dG/Ga] " &"E)E/GLq@G/E)EG/GN@/ D E@]$B b]$B Ba!G/Gi)v H i.] +GGB<@/ D@IJE/G@G / &"+JEG/Gq@G/G)V H TG)鷴/ &1"+GGq@G/()?EE5@P^0@@P^E/G@GΥXG/G@[XG/G4@[=$x! aG=&R1"P^sSXGGp@G^>^~ (0ޥ8@^H~CkG/G/G '#>C^>^~ (0޵8F 1F@HG=&1"E/Gtp@/G)E G/" 0`@(B_`G=&1"/Go@GE/Gȫ@/D = `}G@/4G=&1"EDtGE/G @/@a= ! @8 D B8@D"D E@Ep}G@G = UB `}GGt@4G=&ʡ1"E=&1"x}G@/ D= `}Gb@/4G=&1"EDG/Gp@E/G @GO )O "@O "@ a $ &"/G^~ (0ޥ8CkG/G 'P#>C^>^~ 1F4`A",A"H'H%@ kEG/G@ӓ4B",A"H'H%@ &"=&¢1"d_"}&̢s"G/G@ GGG/GB4@@",A"H'H%@ gA4@@",A"H'H%@ 0@B4@@",A"H'H`gA4@@",A"H'H a@?B4@@",A"H'H%@ gA4@@",A"H'H%@ 0@ D GBBD4@@ G4`@",A"H'H%@ 0@A0@B4`@",A"H'H?iJAlAG/GD@  A4 AG/GT@ DG C" %ע!&٢"G/c@#A,(,HA (HD,H#,C, HdHA #HBCH%DDD#<C<C,T`@BAHaH"D#<0@ @?p@0AlA/G2@/)E^>^~ CkG '#>C^>^~ (0G F 1F/G@/ D GU A1 AA D#C^ b@ B C@?cD GGkEG/G@C$@=$ۢ! a,A,aHB AHbD, @H$,D, dHcdHA $HBDH'DCD$<D<$,A%HeHD<8 4GCAA D#C^ b@ B C@?cD GGkE/G@/C=$! a,A,aHB AHbD,A, @HB AHD$,D, dHcdHA $HBDH&DCD$<D<D,d,@ HeHB AHCaHFDeDD<d<=$p! ! kEG/G@ӽ)?(kEE}GG@= `}G:@/4G=&1"kEED/Gm@/GG/Gx@ DkEG/G@ =$p! AI!E^>^~ (0CkG/G/ '#>C^>^~ (0޵ F 1F RFsF G TG4@A$,A$H'HUd@d@"D cD 4G D,QA)!5 @)?@ A)E/G<@G IkEb,CbHa"H#D"<4@@IE)E}G@/JEECCt@ H>@^RF4G22@)E}GV@/ LA MA)!5 @)?@ A)EG/G@ IkEb,CbHa"H#D"<4@@IJE^>^~ (0ޥCk '#>C^>^~ (0޵8G F 1FRF sF FJEG/G@ @kEG/G@  A !A E#C^ b@ B C@?cDG=&1"JEkE}GG@EEEGc_E^>^~ (0ޥ8CkG/G/G/BGB 4BA,BAHGHuD@ D@ 4G`4GG4BB?GkG/G/G/G 'P#>C^>^~ G Fa= !^ )EG/G@/ DU` )E)E/G^@/kA @0@ @ D#C^ b@ B C@?cDG4@ABD",A"H'H' GtGGD",A"H'H'@ *,*HC,BCHa#HC,BCHaI"D#<4`@C,BCHaH"D#<4`@C,BCHaH"D#<4`@ 4@A4@A$,A$H'H?!p@%@ &"=&¢1"[_"}&s"G/G@#,A#H#<)E/G@/E^>^~ CkG 'p#>C^G4BBD",A"H'H 4 BBD",A"H'H G/GD,BDHGH#,A#H'HA@ @DcD0@4B$,A$H'H 4 B#,A#H'H?4B",A"H'H 4 B",A"H'H# 4B",A"H'H 4 B",A"H'H G 4B",A"H'H1D4B",A"H'H%@"5B"D4B",A"H'H%@ TB",A"H'H 4G=&%1"/Gʯ@/@^CkG/G/G 'З#>C^>^ F 1FJERFG/G@= )EG/G8@)E}G@/JE}GG@G^>^CkG/ '0#>C^F= =G/Gv9@^CkG '#>C^>^~ F 1F=!) GG/G9@ G=!) GG/G9@ = ECCG/GT7@&kE8>GG\@G_kE8>1_= kE/G7@G&= E/G8@G0}GGJ@8}GF@/E_]!E/G\@/ DkE/GV@G )EDG/G 8@=! kECC/G7@G kEG/Gj8@8}G@G0}GG@]!kEG/G.@ DEG/G(@ )ED/G7@G^>^~ CkG/G/ '#>C^>^~ F 1F=!) GG/G09@ G=!) GG/G&9@ = JEG/G~6@ D @&"=&¢1"_"}&1s"/G@/}! EG/G6@EG/Gؠ@ DJEG/GҠ@ )ED/G7@G^>^~ CkG/G/G/ '0#>C^>^ F=!) G/G8@G =!) GG/G8@ =! JECCG/Gh6@ JE/G7@G }GGr@(}Gn@/JE_^>^CkG/G/G/ '0#>C^>^ 1F=!) G/G8@G = JEG/Gz6@= JEG/G@=! JE/G0@G ^>^CkG/G 'p#>C^>=! G/G@ GG5@G=! GG@G G/G5@= G/G@=! G/GB@^>CkG/G/G/G '#0J5B UB uB $x $| $ $ GkG/G/G/G '#>C^>^~ F 1Fu`A = !- = )E/Gn5@G D# $]!* G/G8@G ]! )E/GZ5@G D kE_ )EG/GŸ@ DC/Gx6@/G >^>^~CkG/G '#>C^}GG@G^CkG/G/ '#>C^>=! 戃=GG/GT7@ GG5@G^>Ck 'P#>C^>GG/GD@ DGG/G7@ )E^>CkG '#>C^>GG/G,@ D)EG/GT@/? ))E^>Ck '#>C^> F 樃}GG,@ 樃}GG&@G/0 樃}GG@G/8 樃}GG@G/)E}G@G^>CkG/G 'Ќ#>C^>^~ ^ 1F RF*G/G4@ D _G )G/G@0 0)GG@G*I"@ K)E0>0^J]@)?G^>^~ ^CkG '#>C ^(>0^ F 1F )CCG/G4@"JE)EC_P> @@@AH^@@@IDz_*!5 @*a= ! &H"G/G6i@ G/GH^@I@ GG@G@ @>)E/Gj5@G*4 @*a= !+ $) $A}GG@D}Gr@G$n )I4@B$ }&s" i]$B &")>0I^8I^&z"DbDG/Gh@ ^(>0^CkG '#>C^>^ F 1F GG\6@GBJE)EC@_ D< > @I@A*( )CGG/G 4@ &ã"=&1")_"}&s"G/Gp@@) )G/Gl5@(}G@G (>@IGG4@/)E_Ӑa= ! &"G/Gh@G/^>^CkG/G '#>C^>^~ (0G F 1F RF sF FA4@E &ã"=&1"U_"}& s"G/G(@0- `A4 E JEE/GN@G0 )EkEG/GF@8 !A @$ JE=&,1"G/G@G`A4 E +A 樃}G@G/G/4 A0,A0H'H%@)DkE/G @G !A @ JE=&31"GG/Gj@`A4 E +A  樃}GG@)EkEG/G@ !A @ JE=&81"G/GL@G4`A4 Eq +Ao )E)iA A0 A @ D#C^ b@ GB C@?cDʷG)E/G\@G*)@A,BAHA<@GG@W@/4@ 4G -$ = $M! A@c@4G(-`!A @O JE=&@1"G/G @GF=$X! APO`A4 E- +A+ )E)pA A0 A @ D#C^ b@ GB C@?cDʷG)E/G@GJI@",A"H"^~ (0CkG/G/G '#>C^>^~ (0޵8GHP/XOz_` GHOhpG G4@A",A"H'H/"aI7A@ H=AA@!=@k GP=?EB@A@","H(D "5$AK@U$A8 DAD}@䢵'A8@Du'A8 DADw@䡕%Au hO 4Gáu'A4 E 'A P=?EB@A@","H(D pO TG"5$AK@U$A8 DAD\@䢵'A8@Du'A8 DADV@䡕%Ah Sá Au'A"D GGU@Oá'A 4@A4@A",A"H'H tGP=?EB@A@","H(DN 9á Au'A"D JEJE;@5áU$A 4@A4@A",A"H'HJE GuP=?EB@A@","H(D3 JE G Giáu'A4 E P=?EB@A@","H(D JE G[ GáU$A JE 4@A4@A",A"H'H GO 4GLáu'A 4@A4@A",A"H'H GC?P=?EB@A@","H(D? 4@A4@A",A"H'H4`h/pOEEPo@[k 'Ā#)Xhp+@ A0`A @ D#C^ b@ GB C@?cD̷GkE/G@G,+@A,BAHA<4G=&`1"@OG/G,f@ӳ G!aA7 @?aA ``_ӡ5aA `}Gb@GX 4G=&1"HO3RAG/Gf@GE^>^~ (0ޥ8CkG/'p#P}4B",A"H'H!@#@A,AH@Dc 4BP}4B4B",A"H'H!@#@A,AH@D?4B",A"H'HBD%@N P}4B",A"H'H!@#@A,AH@DC 4BP}4B4B",A"H'H!@#@A,AH@D?4B",A"H'HBD%@. P}4B",A"H'H!@#@A,AH@D# 4BP}4B4B",A"H'H!@#@A,AH@D?4B",A"H'HBD%@ P}4B",A"H'H!@#@A,AH@D G/GG4BP}G/G4B4B",A"H'H!@#@A,AH@D?4B",A"H'H4G DkG/G/G/'0}#>C^>^~ (0޵ F1Fa= ! &ؤ"/Ge@G/G/kEX_kEE/G@/@Ða= ! &ߤ"G/Ge@kEEG/G@ӝa= ! &"G/Gve@EkE4G/G$@G: 4G G G4`A",A"H'H%@ BD+Da= ! &"/G\e@G/G/G/4@A",A"H'H %@  T@A",A"H'H 4G )E G 0A 0 A 4@Aa= ! &"/G8e@G/=A GQ 4GÐa= ! &"/G(e@G/UA G G%!G/A,AkE!4GG/Gʞ@ 0 A A?}A@E?a= ! &"G/Ge@4`A",A"H'H%@ kE/G:@/ @E/G4@/@ @ " @N@",A"H'H%@?a= ! &"G/Gd@4G^>^~ (0ޥCkG/G/G/'y#>C^F1F!D@^CkG/G/G'py#>C^>^~ ( F 1F RF sF FG}G:@/= )E=GA_ DA ) JEG/G,@  JE_4G=&1"JEiG/GPd@ }G@G kE_a= ! &L")kEG/Gzd@kEG/G@ G() E)E _E)E_ )E_^>^~ (CkG/G/'w#>C^>^~ (0޵ F 1FRF G GG1@GG%)E_ 4G)EG/G@/ D G/ )EG/GH/@JE 0@AA.@ 0`A lA )EGG/G@ 4@JE^>^~ (0ޥCkG/G/'v#>C^>^~ F 1F4 A",A"H'H%@ 4 A)E/G<@/ @kE)EJE/G@G0@AG^>^~CkG'v#>C^>^~ F1F sF F$I@= ! A@ IB@D I4@@ R@ ) )GG@GkE)_G@ 4G^>^~CkG/G/G/G'0u#>C^>^~ F 1F*K00"GG@/ D*K88"G/G@Ӊ E?A^>^~CkG/G/G/'t#>C^>^~ (0޵8 F! JAG}}GG@ E EA /A/G//A i0 0,G/Gʦ@8 8,GGĦ@G*A IJIJ BA "A.A? MAH@^>^~ (0ޥ8CkG/GQ0"A@  0 @BDk'Ps#>C^>^~ (0޵8G F1FHOPoXEG/G@/0@@@#C^ b@ B C@?cD`Ϸ)EEG_ D$G}G@/= p G C G/G`ϤAAA @JEEHOPoXG_pϤ0@pϴ@J_ 0A A?pϤGpϤ!H#C^ b@ B C@?cDhϷ G G C! G/G`ϤAAA@JEEHOPoXA_ )`IhϤ &AI GG@G @O I 0`A@J_ 0A A?pϤfA &ã"=&1"_"}&ns"G/G^@hp/_phDG}}GG@x GpϤ C G/G!IhϤ&@!0 GG̶@/ D8 GGƶ@/0@ @xϤ@x 0ApϤ A?pϤ!5@!@xϤ@p!@x/!DG/GƗ@D=$|! a,A,aHBAHbD,!@H.,N,nHcnHA.HBNH%DCD.<N<N,ABAHaH"D.< G GpϤ CC !IhϤ&@!0 GG@/ @8 GG@/ @0 AJE/G@/ LAE 0AAC,BCHGaH"D#<8 AkEG/G@ lAEpϤ!1@ A 0AEAC,BCHtGaH"D#< 0AAD,BDHGaH"D$< 0ApϤ A?E 0AEAGC,BCHa#H"D#< 0AEATGD,BDHa$H"D$< 0AA#,A#H#^~ (0ޥ8CkG/G'm#>C^>^~F 1F RF GTG2AA/G@G4@j@ PݤG/4`@$,A$H'HDB@F@","H D A)A!@!&@ @Dj@?j@ )EG^>^~CkG/'l#>C^>^~ (0޵8@^H~Pp 1F)E=&1"Є}G@G= }G@/4G=&1")EDG/G:a@rG}GG@= ^G/Gx>`1F4@",A"H'H PG/G4 B#,A#H'H!@$@A,AHHD cD4 B",A"H'H?4 B!DA,BAHGHuD@4@D2 >BDGcD4 B#,A#H'H @8@D5!@8 DAD_`>1Fޤ@ 4 B0,A0H'H ]FD4@4 B4 BA,BAHGH@@8 D5A@8@D"D?>^ޤ@ 1F4@0,A0H'H ]FD4@G/G4 B4 BA,BAHGH@@8 D5A@8@D"D?>ޤ@ 1F4@0,A0H'H FE4AG/4 B4 BA,BAHGH@@8 D5A@8@D"D?>A 4 B0,A0H'H ]FD4@G/4 B4 BA,BAHGH@@8 D5A@8@D"D?1F~ޤ@ 4A0,A0H'H FE4AG/G4 B4 BA,BAHGH@@8 D5A@8@D"D? 1FA 4A0,A0H'H FG/Gܴ@ @A*A ),A)H'HU!@)!A*A ),A)H'H!@)!A_ DEE/Gl@G0 JE)EG/Gd@8 D>GG\@G Gޤ!@ @ E=&1"G/Gd@/4GDK G^ޤ!@ @ D=&1"G/GR@G 4G+`>Cx_ 4@0,A0H'H%@%D`>G/G&@ F _[h^=$ȥ! a*KYh^/,A/H/<~D=&H1"C@}GG@ F _[h~jY @[ _$K4G +pkE_kEP_x}G@GG/G@x}GV@G^>^~ (0ޥ8@^H~PCk'Pf#>C^> ^(~08@޵H RF F 1FE !!%!}%k!/G/ )8 $I@/ A@3 ) GJE}GB@/EJE}G@GINB JE=&Х1"}GV@GI]&R"i)$_0I^8I^JE=&ԥ1"KDE+D[}G@@G*$D 4G@)?G^> ^(~08@ޥHCkG'd#>C^>^~ F 1Fa= ! &"G/G_@G/G}G @/= JE=&1"Є}GG@ D = }GGv@4G=&1"JED/G(_@GT& ")E}G6@/GG/G@)E=&1"D}GG@&:")E}G"@G =)EG/G,@)$D = }GB@/4G=&U1"JEDG/G^@)E}G|@G= }GG,@4G=&p1"JED/G^@/a= ! &"G/G_@G/^>^~CkG/'b#>C^>^^ F 1F)E/G+@/)E}GGd@ @G/G@JJE'_ ^ > !D_G^>^^CkG/'a#>C^> F 0=)E/G&,@G G/G)@)E}G:@G^>CkG'a#>C^>^~ F@}HG4 A!DA,BAHGH@@8 DE@8@D"D G cD4 A#,A#H'H @8@D%@8 DAD_4 A",A"H'Hu 4 A4 ABD",A"H'H @#,A#H'H!@$@A,AHHD cD4 A#,A#H'H?4 A",A"H'HY 4 A",A"H'H!@+@A,AH@D? G@ G/G4 A",A"H'H!@$@A,AH@D 4 AC,BCHGH"F@AJA!@ A@ cD4 A",A"H'H?4 A",A"H'H, 4 ABD",A"H'H @#,A#H'H!@$@A,AHHD cD4 A#,A#H'H?4 A",A"H'H ?D,@A,AHUL@z?)E=&1"GG/Gh@qJEG^>^~ CkG/G'^#>C^> ^(~08@޵HGFx/O sF﷠ &"=&˦1"tG}&Ѧs"G/G@@, &"=&˦1"G}&ݦs"/G@GϤD!@ &"=&˦1"4G}&s"G/G@ӐD &"=&˦1"tG}&s"G/G@PN`OXNhOAA4GG/Gh@`/ a= !`/h/ a= !h/`/ h/ &"=&˦1"TG}&Ls"/Gd@/? \/(췐ϤlH PNH, !. 1F`H, E/GԱ@/ DGGα@/ @T@/Gޒ@/ DE=&[1"`On}Gڲ@/JEG/G/@/ D 4G JEG/Gp_)E1v`IG/Gb_/ DG/Gd_/)EG/G.@`= !'@AÐD AkEG/Gq@AG/Gq@A/Gr@/G=&a1"`OGG\@/a= ! tG=&w1"/G\@/AEhOG/GD@ @H, E}GG@!AA"!HE@ =AA@!=@kG=&w1"G/G[@4G=&y1"/G[@/kE}GG@Ӑa= ! &"kEG/G\@ӠG/GG=&w1"/G[@/4G=&1"G/G[@kE}Gޠ@/a= ! &"kE/G\@GG/G=&w1"/G[@/4G=&ڧ1"G/G[@kE}G@/a= !g &"kE/G\@G_G/G=&w1"/G[@/4G=&1"G/G[@kE}G@/a= ! &"kE/G\@G/G/A/Gq@/4GG=&w1"G/Gt[@4G=& 1"/Gn[@/kE}GGv@Ӑa= ! &"kEG/Gv\@A/Gp@/G{Ða= ! G=&21"/GN[@G}GGf@Ӑa= ! G=&>1"G/G\@A0,"G/G@ @"AIB@ B@ A@5 0áC@ -G=&w1"/G&[@/4G=&y1"G/G[@kE}G(@/a= ! &"kE/G(\@GG=&w1"/G[@/4G=&L1"G/G[@}G@/a= A@@CA8 DAD@G=&x1"/GZ@/a= ! G=&1"/G[@/A8,"/G@/ @"AIB@ B@ A@7 2áC@ /G=&w1"G/GZ@4G=&y1"/GZ@/kE}GG̟@Ӑa= !v &"kEG/G[@nG8 }GG2@G/&"G/GH@8 }GG@0,5 @a 8 tG/GT@/ D@4@AG/GL@/ D GA4@E a= !J &"G/G[@CG/G8,a= ! &"G/G[@Ӑa= ! &"8,G/G~[@GI,BIHa)H"D)< 4 A 4@AMA G/4@A",A"H'H%@ *,*HG),A)HbIHADI< 4@A 4 AMA?),A)H)Z@/a= ! &"8,E)E/G2Z@G/G/ )E0,5 @i E/Gd@/4@D#C^ b@ B C@?cD C)EEG/Gp@4C",A"H'H%@ &"=&˦1"_"}&֩s"/G@/tGI,BIHa)H"D)<4 AT A",A"H'H GG/4`@",A"H'H%@ C,BCHaH"D#<4`@4`@",A"H'H?GC,BCHa#H"D#<4`@#,A#H#@G=&1"DG/G2U@ӀxϤ0B/G.@/G=&1"D/G"U@/G=&w1"G/GBT@x&àϤ$D/G@/G=&1"D/GU@GϤ0@/G@/G=&1"D/GT@/G=&&1"G/GT@\(, >JExOoA/G s@/ DG/G@GxϤ0B(,GG/Gs@D\G/G_Ӑa= ! ,!D JE(}GP@GJE/G@/4@? ADA' = }GG@4G=&:1"@LD/GT@/kE}GGؘ@Ӑa= ! &"kEG/GT@G/A/G@i@/G4A = }GΘ@/4G=&_1"OED/G~T@/a= ! tG=&w1"/GS@/ A)EAG/G@ @)EG/G|i@ӡAA- p}G@/4A 4G=&1"OEG/GTT@4G=&1"/GvS@/kE}GG~@Ӑa= ! &"kEG/G~T@A/Gh@/4Gp4B",A"H'HU&@ }GGڡ@4A 4G=&1"OE/G"T@/4G=&1"G/GBS@4Gdp}G¡@/4A 4G[ÐD kE}G>@/a= ! &"kE/G>T@G/G/A/Gh@/a= != ,!D: @ G/G@@ =&1"}G@/ D @= }G"@/tG=&1"@LDG/GS@G/GtG=&1")EG/GS@)E}Gp@/JEG/G@ D?JE(}GD@/TGE^> ^(~08@ޥHCkG/G'6#>C^> ^(~08@޵H1F RF@* GG@G@ a= @! @ G/GT@ G=&1"@JGGS@/TG@ G/G@Ӑa= ! @ʥÐa= G* 4G** H0 D>G/ 0AEG/GLu@* G*AA/Gg@G*q D*t DAA/Gg@G*1 D*4 D**P D *Q D*T D* G=A a= ! *!D E/G@GECp}GG|@ _ B$X>"D_ !!HB$"@p^"Da= A C@D *$D*GG/G@ Da= !1 4GG/G\@ D=$! a,A,aHBAHbD,!@H~^_DD"D>=A C="E}G@/G=&-1"kE)ECEG/GR@)E}G@GO^ðCEJE_ @AA/Gpg@G*Q D*T D*!5 A"!HF@ 䀇=AA@!=@k)E>O"@ a= E!GGt@G}GG@G/GN@/ Da= d! 0 B(*G/Gq@G4GEG/Gf_*  }G@/a= ! &"*GGR@G/G/AA/G$g@/a= d! G=&F1"kE~EGGhR@/a= ! 4GG/G@ DTG=&c1"kE)EE/GRR@/)E}GG@*!D a $< } #^"@#$4 @$3Ða d$0 } #^"@#$4 @$$& $ &"G/GhR@G/G=&1"EG/GR@E}GЗ@G= }GGX@4G=&ͯ1"DG/G R@*"D*"D*TG$Ða= !? A?AAG/Gf@*  }GG$@Ӑa= ! &"*G/G$R@G/AA/Gf@/G^> ^(~08@ޥHCkG/G/'.#>C^>^~ (0^ F 1F RF@J*1 D**#D D*GG@/ D)E=&1"/G@/ D)E}GV@/a= ! &Ű"kE/GQ@G/G/@jEGJE_ @@JU$A kE0*GGX@G a= ! kE}GG6@ = }G@/4G=&ͯ1"DG=&1"kEG/GlQ@kE}G@G*!D*)E^>^~ (0^CkG/G/',#>C^>^~ (0޵8@^H~G F 1F RF=&1"14 @1a] ,B4@B 1 2B " &"/GrQ@G/G/]$B "!5 @"tG @&"=&˦1"(_"}&!s"/G@GOOJ])1 D)P D )T D)Q D))"D)!A/Ge@G)4 D)1 D)TGK@G/a D@= ! "@U @IH GG@GE*G/Gv@E/Gڂ@G@ TG 4Ga $/ *- DAp}G*@G&pOo0IU@@4@D *AB4G!D* #@"D G=&+1"@IGGP@/ G @G=&i1"@IG=&1"G/GP@*"!H5@@ @U@@ u@@ Ða $} (* 4G=&ر1"G/GO@ӂ@ Aȇ}G@G8( GG@/ 4@X/_ B$"D!!H_ B$"@) `A D#C^ b@ B C@?cD@ GAЇ}GG@!5`A@ G(*DG/G@ G=&1"@I(jG/GXP@ GCG=&(1"@I(jGGNP@G@ }GG@( @)}GGȰ@ @= }G@/4G=&C1"D/G2P@/G=&w1"G/GRO@Ða $ 4G=&P1" EJE)Ey_@4G=&j1"JGGP@G*U @ a $ * $@8 D,D @ G/G·@Ga= A@! BD@ *G/GV@ * $@ 4G=&1"@IGGO@G * * @,D @ ؆}GG@ Ða $ &"@)GGP@G/@ }Gx@G@IE/G/GR@Ӡ}Gl@G#If@5`@"D c@ )q D)8J_a] "( ,B4@@ =$! ! "@ EoD)E4@@]$B "!5 @"GÐa] " " =$! &ɲ"!,BG/GO@G/]$B "!5 @"EE^>^~ (0ޥ@^H~8CkG/G/G' %#>C^>^~ (0޵8@^G F 1F RF_`a!GN@= ! "@ +5 @} @ G/Gʣ@ D G/Gģ@ AP A@@ @@ D#C^ b@ B C@?cDPϷPOJ]POP D@,4 A",A"H'H %@ T A",A"H'H JE=&1"JE=&1")Ek}GG@Ӵ. &"G/GNO@Ӵ. &>")EKJE/GDO@G/JE4GG/GȈ@ G=&o1"JE/GN@G-Q D-@ G/G@ DEJE/GT~@/EE4GC@E)E/GJ~@/)E}GG@8kxa= A@= ! "@G TGE^>^~ (0ޥ@^8CkG/G/G/G'@"#>C^4B",A"H'H%@ =&1"G/G<@G4DcD4G^Ck'!#>C^>^~ (0޵ F 1FRF+"D+C_@U@ @+= }GȒ@/4G=&1")EDG/GxN@XÐa] h" p" @> G/)5 @  G/G@ G=&1"IGG^N@/)ECF@ D8)?@> G/ _ G=&1"IGGHN@/)EC0@ D8)?HL4@@",A"H'H! UA4E G@> !/H )G/G_/ DMA?5@A )EC@ D8)?4@A @7@G#@> EkE_ +4 D+EGkEg_@G=&1"HLGGN@G@@Ӑa= A@= ! "@G TG^>^~ (0ޥCkG/G/G/G'# #^>^~ F 1F RFCP?"/G@/CG/G|b@4G0>`hx>HK4@@",A"H'HS a=!)P kEC^"_ @UDAh )D d)B GG|@G pG/Gt@kEG/G@ D)EkE^G/G@ @AA a] " " )E>"p}GG@? ~4G=&ٳ1")ED/GM@G4G=&1")EG/GxM@)E}G"@G@H GG>@/a} # @8 D@8@D"D # # a= !@4 DkECRB_kEGC_ @AAT$DUDA ,T D,C/Ga@G8}Gv@/a= ! &"8>GGvM@G/G/h}GGښ@G/hp}GҚ@G/pJE^>^~ #kG/G'#>C^>^~ F 1F0i8I }G@G( }G@G/)E}G@G@0j`8KLJE^>^~ CkG/G/G'#>C^>^ F 8I }GG@( }GG@)E}G|@G ^ > !D?^>^CkG/'p#>C^>^~ ( F 1F GG/GF@G a!G G/G/!1A AA A ?@ E/GL@G ) !5 @ A))E/GLa@G @))!1 @)kj@$,$HC,BCHa#H"D#<4@4G5 @ +*@4`@",A"H'HU!@ #,A#H#<@KBA#5@@",A"H'H!@ #,A#H#<GM 0@Aì- tG=&(1"KG/GVL@ ô- &("+G/GL@G/]@A?hk4`@",A"H'H!@$@A,AH@D?T`@",A"H'H!@$@A,AH@D?t`@",A"H'H!@$@A,AH@Dz?`@",A"H'H$@t?c"cDG/G֬@/c= A,/@BCHA<G^>^~ (CkG/G'#>C^>^~ F 1F/G|@G @ 4@JEG/Gt@  A t A t@)E/G@/ D}&7s"sF=$5! )E=&,1"kEAEJE}Gx@/a= ! )E=&81"GG/G@ tG=&=1")E/GK@GtG=&E1"/GJ@G Ða= ! &]")EG/GK@)E^>^~CkG/G/G'#>C^>^~ (0޵ F 1FRFC_ @!A @4B",A"H'HU&@ }G<@/G@}GG4@&f"JEz_ D,JE/G@/)EJE@G/G_}JE}GG@EC_ @!A @4B",A"H'HU&@ @4B",A"H'Hu&@= G%!/AmA!@^)EG/G̟@)EJED/GĦ@G 0`A7`A?7`A3 G=$! AaAG/G@@>@ G/GB)AB@4@#,A#H'H"@)&@cD , H!&@7!@?4@ ,A H'H$@ @}GȘ@/4GM)EDEG/G@D@}G@/&8"E_ D,JEG/G|@)EJE@/Gx_GJE}G@/G%JE}GG@EC'_ @!A @}G@/)E@4B",A"H'HU&@ 䠈}GG@G@}Gz@/G^>^~ (0ޥCkG/G/G/G'P#>C^> ^(~ F C`>!?H`>CTGG/G@_ @U!A )Ej C/G_GCCG/G\@4GZJ.,4@A,T@Aj,t@A`>,C"H!H>`>,"H?D>C=&1"JJHHuH}GG@&"Cl_ D+JE/G@/)EJE@G/G_JE}GG@G%JE}G@/kEC_ @!A h}GG@)Eh4B",A"H'HU&@ 䠈}G@/Gh}GG@TG^> ^(~CkG'0#>C^>^~ ( F 1F RF&"G_ D,JE/G@/)EJE@G/G_JE}GG@GJE}G@/ECD_ @!A 8}GG@)E84B",A"H'HU&@ }G@/G8> Ah}G/G 4 A4 A",A"H'H ?D!@#@A,AH@D?4 A",A"H'H GGhG/CF@",A"H"<4 ABD",A"H'H!@'@A,AH@D C@G/I,IHd,dH?DA!@!@"F@A@CdHaDH#D$< D4 A%,A%H'H!@'@A,AH@D?4 A",A"H'H%@: BD0@}@?CEG/G@@+,A+H+^~ (CkG/' #>C^>^~ F >?D?F!F1?J >&"C_ D+JE/G@/)EJE@G/G_JE}GG@G%JE}G@/kEC2_ @!A (}GG@)E(4B",A"H'HU&@ 䠈}G@/G(}GG@G^>^~CkG/G/G' #>C^>^~ F&"_ D+JEG/G6@)EJE@/G2_GJE}GZ@/G2JE}GGR@kEC_ @!A }GH@/)E 4B",A"H'H&@ 䠈}GG:@tG 4B",A"H'HU&@ 䠈}G.@/G }GG&@G^>^~CkG/G/G/G' #>C^>^~ F`"/G@/&"`="Q_ D+JEG/GМ@)EJE@/G_GJE}G@/G%JE}GG@kEC{_ @!A }G@/)E 4B",A"H'Hu&@ 䠈}GGԕ@G }GΕ@/TG^>^~CkG/G/G/'#>C^>^~ F&"_ D+JEG/G~@)EJE@/Gz_GJE}G@/G2JE}GG@kEC)_ @!A }G@/)E 4B",A"H'H&@ 䠈}GG@tG 4B",A"H'H5&@ 䠈}Gv@/G }GGn@G^>^~CkG/G/G/G'0#>C^>^~ F&"_ D+JEG/G@)EJE@/G_GJE}GB@/G2JE}GG:@kEC_ @!A }G0@/)E 4B",A"H'H&@ 䠈}GG"@tG 4B",A"H'H5&@ 䠈}G@